Transcription Factor
| Accessions: | E2F3_TF1 (HumanTF2 1.0), E2F3 (HT-SELEX2 May2017) |
| Names: | E2F-3, E2F3, E2F3_HUMAN, Transcription factor E2F3, ENSG00000112242 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | O00716 |
| Notes: | Ensembl ID: ENSG00000112242; Construct type: TF1(SBP); TF family: E2F; Clone source: Jolma et al. 2013, TF family: E2F experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: E2F experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 109 |
| Pfam Domains: | 24-89 E2F/DP family winged-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 GKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQ 60 61 KRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEV |
| Interface Residues: | 24, 60, 61, 62, 63, 65 |
| 3D-footprint Homologues: | 1cf7_A, 4yo2_A, 1cf7_B |
| Binding Motifs: | E2F3_DRGX sGCGCTAATTks E2F3_EOMES argYGykAtGGCGCstTmrCrcyt E2F3_FOXI1 tGACACCGCGCCCaC E2F3_FOXO6_1 gaaTGACACGCGCCCmc E2F3_FOXO6_2 gaaTGACACcGCGCCCac E2F3_HES7 wwdsGCGCsmwyggCrCGyGbc E2F3_ONECUT2_1 wdsGCGCsmwTATyGAyy E2F3_ONECUT2_2 wdsGCGCshwwTATCGAyy E2F3_TBX21_1 agGTGtsAdgGCGCst E2F3_TBX21_2 rgGTGykAwgGCGCstTsdCrcg E2F3_TBX21_2_3 agGtGtgAatsGCGCsT E2F3_2 rWTTTGGCGCCAAAWy E2F3_methyl_1 rTTTTGGCGCCAAAAy |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.