Transcription Factor
| Accessions: | UP00425A (UniPROBE 20160601), FOS_HUMAN (HOCOMOCO 10), P01100 (JASPAR 2024) |
| Names: | AP-1, c-fos, Cellular oncogene fos, Fos, G0/G1 switch regulatory protein 7, G0S7, Proto-oncogene c-Fos, FOS_HUMAN, Fos proto-oncogene, AP-1 transcription factor subunit, Protein c-Fos, Transcription factor AP-1 subunit c-Fos |
| Organisms: | Homo sapiens |
| Libraries: | UniPROBE 20160601 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Hume MA, Barrera LA, Gisselbrecht SS, Bulyk ML. UniPROBE, update 2015: new tools and content for the online database of protein-binding microarray data on protein-DNA interactions. Nucleic Acids Res : (2015). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Description: | FBJ murine osteosarcoma viral oncogene homolog: Proto-oncogene protein c-fos (Cellular oncogene fos)(G0/G1 switch regulatory protein 7) |
| Length: | 380 |
| Pfam Domains: | 135-194 bZIP transcription factor 137-189 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF 60 61 IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA 120 121 QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ 180 181 TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT 240 241 LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA 300 301 ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK 360 361 GSSSNEPSSDSLSSPTLLAL |
| Interface Residues: | 143, 144, 147, 148, 150, 151, 154, 155, 158 |
| 3D-footprint Homologues: | 2wt7_A, 4eot_A, 7x5e_E, 7x5e_F, 8k8c_A, 6mg1_B, 1skn_P, 5vpe_C, 5vpe_D |
| Binding Motifs: | MA0476.1 dvTGAsTCATb MA1951.1 bgATGACGTCATCr UP00425A_1 kkwATGAsKCATmy FOS_HUMAN.H10MO.A|M01141 rTGAGTCAycs MA0476.2 TGAsTCAT MA1951.2 gATGACGTCATCr |
| Binding Sites: | GTGACTCA TGACGTCA MA0476.2.10 AAAATTTT ACGTCATC ATGACGCA ATGACGTG ATGACTAA ATGACTCA ATGAGTCA MA0476.2.16 CTGACTCA CTGAGTCA GTGAGTCA GTGCGTCA TGCGTCAA MA0476.2.3 ATGCGTCA CGATGACG CGTACAAA CGTCATTA MA0476.2.15 GATGACGC GCAATTGC MA0476.1.1 MA0476.1.10 MA0476.1.11 MA0476.1.12 MA0476.1.13 MA0476.1.14 MA0476.1.15 MA0476.1.16 MA0476.1.17 MA0476.1.18 MA0476.1.19 MA0476.1.2 MA0476.1.20 MA0476.1.3 MA0476.1.4 MA0476.1.5 MA0476.1.6 MA0476.1.7 MA0476.1.8 MA0476.1.9 MA0476.2.1 MA0476.2.11 MA0476.2.12 MA0476.2.13 MA0476.2.14 MA0476.2.17 MA0476.2.18 MA0476.2.19 MA0476.2.2 MA0476.2.20 MA0476.2.4 MA0476.2.5 MA0476.2.6 MA0476.2.7 MA0476.2.8 MA0476.2.9 |
| Publications: | Alibés A, Nadra AD, De Masi F, Bulyk ML, Serrano L, Stricher F. Using protein design algorithms to understand the molecular basis of disease caused by protein-DNA interactions: the Pax6 example. Nucleic Acids Res. (2010) Aug 4. [Pubmed] Nakabeppu Y., Nathans D. The basic region of Fos mediates specific DNA binding. EMBO J. 8:3833-3841 (1989). [Pubmed] Portales-Casamar E, Kirov S, Lim J, Lithwick S, Swanson M.I, Ticoll A, Snoddy J, Wasserman W.W. PAZAR: a framework for collection and dissemination of cis-regulatory sequence annotation. Genome biology 8:R207 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.