Transcription Factor
| Accessions: | RARA (HT-SELEX2 May2017) |
| Names: | ENSG00000131759, RARA |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Nuclear_receptor experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Nuclear_receptor experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 110 |
| Pfam Domains: | 20-88 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 SEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRD 60 61 KNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSES |
| Interface Residues: | 29, 30, 32, 33, 39, 40, 41, 42, 43, 45, 46, 47, 50, 52, 56, 71, 75, 77, 79, 81, 84, 86, 88, 92, 93, 95, 97, 100 |
| 3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 8hbm_B, 4umm_E, 3cbb_A, 7xv6_B, 4iqr_B, 2han_A, 1hcq_E, 7xvn_C, 2han_B, 1kb2_B, 2a66_A, 8cef_H, 5krb_G, 4yhx_A, 5cbz_E, 4hn5_B, 5e69_A, 8rm6_A, 3g6t_A, 1r4i_A, 5emc_A, 7prw_B, 5cbx_B, 4tnt_B |
| Binding Motifs: | RARA_4 rrGGtCAarrGGtCAs RARA_5 rrGGtCrTGaCCty RARA_6 arAGGTCAmg RARA_methyl_1 rrGGtCRarrGGTCRm RARA_methyl_2 rrGGtCrTGACCty RARA_methyl_3 arAGGTCAcg |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.