Transcription Factor
| Accessions: | VSX1_DBD (HumanTF 1.0), VSX1 (HT-SELEX2 May2017) |
| Names: | Homeodomain protein RINX, Retinal inner nuclear layer homeobox protein, Transcription factor VSX1, Visual system homeobox 1, VSX1, VSX1_HUMAN, ENSG00000100987 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q9NZR4 |
| Notes: | Ensembl ID: ENSG00000100987; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 133 |
| Pfam Domains: | 46-102 Homeobox domain |
| Sequence: (in bold interface residues) | 1 LAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEEL 60 61 EKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYG 120 121 AMVRHCIPLPDSV |
| Interface Residues: | 16, 17, 18, 21, 22, 28, 32, 46, 47, 48, 49, 87, 88, 90, 91, 94, 95, 97, 98, 99, 102, 103 |
| 3D-footprint Homologues: | 1au7_A, 3cmy_A, 1ig7_A, 1puf_A, 3d1n_M, 8ejp_B, 6a8r_A, 8pmf_A, 1fjl_B, 5zfz_A, 6m3d_C, 1jgg_B, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 7q3o_C, 2ld5_A, 6es3_K, 1b72_A, 5flv_I, 2hdd_A, 9b8u_A, 5zjt_E, 4cyc_A, 2r5y_A, 8ik5_C, 7psx_B, 5hod_A, 2hos_A, 1puf_B, 8osb_E, 5jlw_D, 8eml_B, 4xrs_G, 3a01_E, 3rkq_B, 2xsd_C, 1e3o_C, 7xrc_C, 8bx1_A, 1du0_A, 4qtr_D, 1o4x_A, 8g87_X |
| Binding Motifs: | VSX1_DBD yTAATTAb VSX1_3 yTAATTRs VSX1_6 cyAATTAm VSX1_methyl_1 yyAATTrc VSX1_methyl_2 ctCrTTAw VSX1_methyl_4 cYAATTAv VSX1_methyl_5 cTCrTTAw |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.