Transcription Factor

Accessions: VSX1_DBD (HumanTF 1.0), VSX1 (HT-SELEX2 May2017)
Names: Homeodomain protein RINX, Retinal inner nuclear layer homeobox protein, Transcription factor VSX1, Visual system homeobox 1, VSX1, VSX1_HUMAN, ENSG00000100987
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q9NZR4
Notes: Ensembl ID: ENSG00000100987; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 133
Pfam Domains: 46-102 Homeobox domain
Sequence:
(in bold interface residues)
1 LAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEEL 60
61 EKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYG 120
121 AMVRHCIPLPDSV
Interface Residues: 16, 17, 18, 21, 22, 28, 32, 46, 47, 48, 49, 87, 88, 90, 91, 94, 95, 97, 98, 99, 102, 103
3D-footprint Homologues: 1au7_A, 3cmy_A, 1ig7_A, 1puf_A, 3d1n_M, 8ejp_B, 6a8r_A, 8pmf_A, 1fjl_B, 5zfz_A, 6m3d_C, 1jgg_B, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 7q3o_C, 2ld5_A, 6es3_K, 1b72_A, 5flv_I, 2hdd_A, 9b8u_A, 5zjt_E, 4cyc_A, 2r5y_A, 8ik5_C, 7psx_B, 5hod_A, 2hos_A, 1puf_B, 8osb_E, 5jlw_D, 8eml_B, 4xrs_G, 3a01_E, 3rkq_B, 2xsd_C, 1e3o_C, 7xrc_C, 8bx1_A, 1du0_A, 4qtr_D, 1o4x_A, 8g87_X
Binding Motifs: VSX1_DBD yTAATTAb
VSX1_3 yTAATTRs
VSX1_6 cyAATTAm
VSX1_methyl_1 yyAATTrc
VSX1_methyl_2 ctCrTTAw
VSX1_methyl_4 cYAATTAv
VSX1_methyl_5 cTCrTTAw
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.