Transcription Factor
Accessions: | 3kov_A (3D-footprint 20241219), 3kov_B (3D-footprint 20241219), 3kov_I (3D-footprint 20241219), 3kov_J (3D-footprint 20241219), 3p57_A (3D-footprint 20241219), 3p57_B (3D-footprint 20241219), 3p57_C (3D-footprint 20241219), 3p57_D (3D-footprint 20241219), 3p57_I (3D-footprint 20241219), 3p57_J (3D-footprint 20241219) |
Names: | MEF2A_HUMAN, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q02078 |
Length: | 90 |
Pfam Domains: | 9-58 SRF-type transcription factor (DNA-binding and dimerisation domain) |
Sequence: (in bold interface residues) | 1 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD 60 61 MDKVLLKYTEYNEPHESRTNSDIVEALNKK |
Interface Residues: | 2, 14, 22, 56, 67 |
3D-footprint Homologues: | 7xuz_H, 8q9q_A, 8q9r_F, 8q9n_B, 8q9p_B, 7yq3_E |
Binding Motifs: | 3kov_AB TTAnnnnnAG 3kov_IJ TTnnnnnTAG 3p57_AB TAnnnnTAG 3p57_CD CTannnntAA 3p57_IJ CTAnnnnTAA |
Binding Sites: | 3kov_C / 3kov_K 3kov_D / 3kov_L 3p57_E / 3p57_G / 3p57_K 3p57_F / 3p57_H / 3p57_L |
Publications: | Wu Y, Dey R, Han A, Jayathilaka N, Philips M, Ye J, Chen L. Structure of the MADS-box/MEF2 domain of MEF2A bound to DNA and its implication for myocardin recruitment. Journal of molecular biology 397:520-33 (2010). [Pubmed] He J, Ye J, Cai Y, Riquelme C, Liu J.O, Liu X, Han A, Chen L. Structure of p300 bound to MEF2 on DNA reveals a mechanism of enhanceosome assembly. Nucleic acids research 39:4464-74 (2011). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.