Transcription Factor
| Accessions: | ERF3 (Athamap 20091028), T000600_1.02 (CISBP 1.02), O80339 (JASPAR 2024), T01708 (AthalianaCistrome v4_May2016) |
| Names: | AtERF3, EREBP-3, ERF3, Ethylene-responsive element-binding factor 3, Ethylene-responsive transcription factor 3, T000600_1.02;, ERF82_ARATH, AT1G50640, T01708; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | Athamap 20091028 1, CISBP 1.02 2, JASPAR 2024 3, AthalianaCistrome v4_May2016 4 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 4 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Uniprot: | O80339 |
| Notes: | experiment type:PBM, family:AP2, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP |
| Length: | 225 |
| Pfam Domains: | 28-76 AP2 domain |
| Sequence: (in bold interface residues) | 1 MRRGRGSSAVAGPTVVAAINGSVKEIRFRGVRKRPWGRFAAEIRDPWKKARVWLGTFDSA 60 61 EEAARAYDSAARNLRGPKAKTNFPIDSSSPPPPNLRFNQIRNQNQNQVDPFMDHRLFTDH 120 121 QQQFPIVNRPTSSSMSSTVESFSGPRPTTMKPATTKRYPRTPPVVPEDCHSDCDSSSSVI 180 181 DDDDDIASSSRRRNPPFQFDLNFPPLDCVDLFNGADDLHCTDLRL |
| Interface Residues: | 32, 34, 36, 40, 42, 44, 51, 53 |
| 3D-footprint Homologues: | 7wq5_A, 1gcc_A, 5wx9_A |
| Binding Motifs: | ERF3 TAAGAGCCGCCACT M0011_1.02 CGCCGcCr MA1005.1 CGCCGcCr M0069 ygrCGGCGGmGrhgg M0074 yGrCGGCGGmgrhgghgryg MA1005.2 dcCGCCGCCry MA1005.3 cCGCCGCCr |
| Binding Sites: | ERF3_1 ERF3_5 ERF3_2 ERF3_3 ERF3_4 MA1005.1.5 MA1005.1.11 MA1005.1.10 MA1005.1.12 MA1005.1.16 MA1005.1.13 MA1005.1.20 MA1005.1.14 MA1005.1.17 / MA1005.1.19 MA1005.1.4 / MA1005.1.6 MA1005.1.2 MA1005.1.3 / MA1005.1.7 MA1005.1.8 MA1005.1.1 MA1005.1.15 MA1005.1.18 MA1005.1.9 MA1005.2.1 MA1005.2.10 / MA1005.2.19 / MA1005.2.20 / MA1005.2.5 MA1005.2.11 / MA1005.2.6 MA1005.2.12 MA1005.2.13 / MA1005.2.7 MA1005.2.14 / MA1005.2.8 MA1005.2.15 / MA1005.2.9 MA1005.2.11 / MA1005.2.16 MA1005.2.17 MA1005.2.12 / MA1005.2.18 MA1005.2.13 / MA1005.2.19 MA1005.2.2 MA1005.2.20 MA1005.2.3 MA1005.2.1 / MA1005.2.4 / MA1005.2.7 MA1005.2.2 / MA1005.2.5 MA1005.2.3 / MA1005.2.6 MA1005.2.8 MA1005.2.9 MA1005.2.10 MA1005.2.14 MA1005.2.15 MA1005.2.16 MA1005.2.17 MA1005.2.18 MA1005.3.1 / MA1005.3.4 MA1005.3.17 MA1005.3.10 MA1005.3.11 / MA1005.3.12 MA1005.3.13 / MA1005.3.14 / MA1005.3.19 / MA1005.3.20 / MA1005.3.5 / MA1005.3.6 / MA1005.3.7 / MA1005.3.8 MA1005.3.15 MA1005.3.16 MA1005.3.18 MA1005.3.2 MA1005.3.3 MA1005.3.9 |
| Publications: | Fujimoto SY, Ohta M, Usui A, Shinshi H, Ohme-Takagi M. 2000. Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression. Plant Cell. 12:393-404. [Pubmed] Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.