Transcription Factor
Accessions: | 2r1j_L (3D-footprint 20231221), 2r1j_R (3D-footprint 20231221), 3jxc_L (3D-footprint 20231221), 3jxc_R (3D-footprint 20231221), 3jxd_L (3D-footprint 20231221), 3jxd_R (3D-footprint 20231221) |
Names: | Repressor protein C2, RPC2_BPP22 |
Organisms: | Enterobacteria phage P22 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P69202 |
Length: | 66 |
Pfam Domains: | 4-60 Helix-turn-helix domain 5-65 Helix-turn-helix domain 8-62 Helix-turn-helix 13-63 Cro/C1-type HTH DNA-binding domain |
Sequence: (in bold interface residues) | 1 TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPD 60 61 YLLKGD |
Interface Residues: | 19, 20, 29, 30, 31, 32, 34, 35, 38, 40, 41 |
3D-footprint Homologues: | 8a0w_B, 2r1j_L, 6fix_D, 3zkc_A, 6yl2_A, 4jcy_A, 6w1a_A |
Binding Motifs: | 2r1j_L TTAAG 2r1j_LR TTAAGnnnnCTTAA 3jxc_L TTAAG 3jxc_LR TTAAGnnnnCTTAA 3jxd_L TtAAr 3jxd_LR TTAAGnnnnTTTAA |
Binding Sites: | 2r1j_A 2r1j_B 3jxc_A / 3jxc_B 3jxd_A / 3jxd_B |
Publications: | Watkins D, Hsiao C, Woods K.K, Koudelka G.B, Williams L.D. P22 c2 repressor-operator complex: mechanisms of direct and indirect readout. Biochemistry 47:2325-38 (2008). [Pubmed] Watkins D, Mohan S, Koudelka G.B, Williams L.D. Sequence recognition of DNA by protein-induced conformational transitions. Journal of molecular biology 396:1145-64 (2010). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.