Transcription Factor
| Accessions: | 1o3q_A (3D-footprint 20260701), 1o3r_A (3D-footprint 20260701), 1zrc_B (3D-footprint 20260701), 1zrd_B (3D-footprint 20260701), 1zre_B (3D-footprint 20260701), 2cgp_A (3D-footprint 20260701) |
| Names: | cAMP receptor protein, cAMP regulatory protein, cAMP-activated global transcriptional regulator CRP, CAP, Catabolite activator protein, CATABOLITE GENE ACTIVATOR PROTEIN, CRP_ECOLI, Catabolite gene activator |
| Organisms: | Escherichia coli, strain K12 |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0ACJ8 |
| Length: | 200 |
| Pfam Domains: | 15-103 Cyclic nucleotide-binding domain 134-198 Crp-like helix-turn-helix domain 158-189 Bacterial regulatory proteins, crp family |
| Sequence: (in bold interface residues) | 1 DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQG 60 61 DFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVT 120 121 SEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRIL 180 181 KMLEDQNLISAHGKTIVVYG |
| Interface Residues: | 19, 73, 158, 163, 172, 173, 174, 175, 176, 177, 178 |
| 3D-footprint Homologues: | 3iyd_H, 4a12_B, 2xro_E, 3e6c_C, 4i2o_B, 5i2d_R, 3mzh_A, 7pza_B, 8h40_X |
| Binding Motifs: | 1zrd_B TgaGA 1o3q_A TGTGA 1o3r_A AAntGcGA 1zrc_B TGTGA 1zre_B TCcCA 2cgp_A tGTGAc |
| Binding Sites: | 1o3q_B 1o3q_C 1o3r_B 1o3r_C 1zrc_Y 1zrc_Z 1zrd_Y 1zrd_Z 1zre_Y 1zre_Z 2cgp_B 2cgp_C |
| Publications: | Chen S, Vojtechovsky J, Parkinson G.N, Ebright R.H, Berman H.M. Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: DNA binding specificity based on energetics of DNA kinking. Journal of molecular biology 314:63-74 (2001). [Pubmed] Napoli A.A, Lawson C.L, Ebright R.H, Berman H.M. Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps. Journal of molecular biology 357:173-83 (2006). [Pubmed] Passner JM., Steitz TA. The structure of a CAP-DNA complex having two cAMP molecules bound to each monomer. Proc Natl Acad Sci U S A. 94(7):2843-7 (1997). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.