Transcription Factor
| Accessions: | 6p0s_A (3D-footprint 20260701), 6p0t_B (3D-footprint 20260701) |
| Names: | DNA-binding protein Fis, Factor-for-inversion stimulation protein, FIS_ECOLI, Hin recombinational enhancer-binding protein |
| Organisms: | Escherichia coli, strain K12 |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0A6R3 |
| Length: | 83 |
| Pfam Domains: | 40-80 Bacterial regulatory protein, Fis family |
| Sequence: (in bold interface residues) | 1 SDVLTVSTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQT 60 61 RAALMMGINRGTLRKKLKKYGMN |
| Interface Residues: | 69, 70, 72, 74, 75 |
| 3D-footprint Homologues: | 5ds9_A |
| Binding Motifs: | 6p0s_ABE GyCtGTTnnnTAnnCA 6p0t_ABE TGTnTTnnnnACAGACTAnA 6p0t_B TgTntT |
| Binding Sites: | 6p0t_C 6p0t_D |
| Publications: | Hancock SP, Cascio D, Johnson RC. Cooperative DNA binding by proteins through DNA shape complementarity. Nucleic Acids Res 47:8874-8887 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.