Transcription Factor
| Accessions: | ONECUT1_DBD (HumanTF 1.0), ONECUT1 (HT-SELEX2 May2017) |
| Names: | Hepatocyte nuclear factor 6, HNF-6, HNF6_HUMAN, One cut domain family member 1, One cut homeobox 1, ONECUT1, ENSG00000169856 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q9UBC0 |
| Notes: | Ensembl ID: ENSG00000169856; DNA-binding domain sequence; TF family: homeodomain+cut; Clone source: Gene synthesis, TF family: CUT_Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: CUT_Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: CUT_Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: CUT_Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 203 |
| Pfam Domains: | 24-103 CUT domain 124-177 Homeobox domain |
| Sequence: (in bold interface residues) | 1 QLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQRITTELKRYSIPQAIFAQRVLCR 60 61 SQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEHGKDRG 120 121 NTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNARRRSLD 180 181 KWQDEGSSNSGNSSSSSSTCTKA |
| Interface Residues: | 54, 55, 56, 59, 60, 61, 62, 63, 64, 66, 67, 70, 74, 84, 87, 100, 124, 125, 126, 127, 165, 168, 169, 172, 173, 175, 176, 177 |
| 3D-footprint Homologues: | 1au7_A, 2d5v_B, 2o4a_A, 6y93_B, 8pmf_A, 6m3d_C, 6es3_K, 5hod_A, 8ik5_C, 1e3o_C, 6fqq_E, 8g87_X, 1o4x_A, 4qtr_D, 6fqp_B, 1puf_B, 8bx1_A, 4xrm_B |
| Binding Motifs: | ONECUT1_DBD aaaAAATCrATAww ONECUT1_2 gyATCGATys ONECUT1_4 kTATCGATCGss ONECUT1_methyl_1 kTATTGATyk ONECUT1_methyl_3 kTATTGATysrt |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.