Transcription Factor

Accessions: GATA5_DBD (HumanTF 1.0), GATA5 (HT-SELEX2 May2017)
Names: GATA-binding factor 5, GATA5, GATA5_HUMAN, Transcription factor GATA-5, ENSG00000130700
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q9BWX5
Notes: Ensembl ID: ENSG00000130700; DNA-binding domain sequence; TF family: GATA; Clone source: Gene synthesis, TF family: Znf_GATA experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Znf_GATA experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 148
Pfam Domains: 27-60 GATA zinc finger
81-114 GATA zinc finger
Sequence:
(in bold interface residues)
1 VLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGV 60
61 NRPLVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAM 120
121 KKESIQTRKRKPKTIAKARGSSGSTRNA
Interface Residues: 36, 37, 39, 49, 53, 90, 91, 93, 103, 107, 108, 111, 128, 130, 131
3D-footprint Homologues: 3vd6_C, 4hc9_A, 1gat_A, 3dfx_B, 4gat_A
Binding Motifs: GATA5_DBD wGATAAsr
GATA5_3 swGATAAsrr
GATA5_4 hGATAAsrATCt
GATA5_7 cwGATAAsrm
GATA5_8 wGATAAcrATCt
GATA5_methyl_1 cwGATAAsra
GATA5_methyl_2 wGATAAcGATCT
GATA5_methyl_5 cwGATAAsra
GATA5_methyl_6 wGATAAcrATCW
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.