Transcription Factor
| Accessions: | GATA5_DBD (HumanTF 1.0), GATA5 (HT-SELEX2 May2017) |
| Names: | GATA-binding factor 5, GATA5, GATA5_HUMAN, Transcription factor GATA-5, ENSG00000130700 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q9BWX5 |
| Notes: | Ensembl ID: ENSG00000130700; DNA-binding domain sequence; TF family: GATA; Clone source: Gene synthesis, TF family: Znf_GATA experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Znf_GATA experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 148 |
| Pfam Domains: | 27-60 GATA zinc finger 81-114 GATA zinc finger |
| Sequence: (in bold interface residues) | 1 VLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGV 60 61 NRPLVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAM 120 121 KKESIQTRKRKPKTIAKARGSSGSTRNA |
| Interface Residues: | 36, 37, 39, 49, 53, 90, 91, 93, 103, 107, 108, 111, 128, 130, 131 |
| 3D-footprint Homologues: | 3vd6_C, 4hc9_A, 3dfx_B, 1gat_A, 4gat_A |
| Binding Motifs: | GATA5_DBD wGATAAsr GATA5_3 swGATAAsrr GATA5_4 hGATAAsrATCt GATA5_7 cwGATAAsrm GATA5_8 wGATAAcrATCt GATA5_methyl_1 cwGATAAsra GATA5_methyl_2 wGATAAcGATCT GATA5_methyl_5 cwGATAAsra GATA5_methyl_6 wGATAAcrATCW |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.