Transcription Factor

Accessions: 4r2a_A (3D-footprint 20260701), 4r2c_A (3D-footprint 20260701), 4x9j_A (3D-footprint 20260701)
Names: AT225, Early growth response protein 1, EGR-1, EGR1_HUMAN, Nerve growth factor-induced protein A, NGFI-A, Transcription factor ETR103, Transcription factor Zif268, Zinc finger protein 225, Zinc finger protein Krox-24
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P18146
Length: 86
Pfam Domains: 4-28 Zinc finger, C2H2 type
4-28 C2H2-type zinc finger
21-44 Zinc-finger double domain
34-56 Zinc finger, C2H2 type
34-56 C2H2-type zinc finger
48-72 Zinc-finger double domain
62-84 Zinc finger, C2H2 type
62-80 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEK 60
61 PFACDICGRKFARSDERKRHTKIHLR
Interface Residues: 16, 17, 18, 19, 20, 22, 23, 44, 45, 46, 47, 48, 50, 51, 52, 72, 73, 74, 75, 76, 77, 78, 79, 80
3D-footprint Homologues: 7n5w_A, 6jnm_A, 1tf3_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 2wbs_A, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 2kmk_A, 7ysf_A, 6ml4_A, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 6a57_A, 7y3l_A, 3uk3_C, 8cuc_F, 7txc_E, 5k5i_A, 1llm_D, 2drp_D, 5yel_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: 4r2a_A GCGTGGGcg
4r2c_A GCGTGGGGt
4x9j_A annCCCAnnC
Binding Sites: 4r2c_B
4r2a_C / 4r2c_C
4x9j_B
4x9j_C
4r2a_B
Publications: Hashimoto H, Olanrewaju Y.O, Zheng Y, Wilson G.G, Zhang X, Cheng X. Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence. Genes & development 28:2304-13 (2014). [Pubmed]

Zandarashvili L, White MA, Esadze A, Iwahara J. Structural impact of complete CpG methylation within target DNA on specific complex formation of the inducible transcription factor Egr-1. FEBS Lett 589:1748-53 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.