Transcription Factor
| Accessions: | 4r2a_A (3D-footprint 20260701), 4r2c_A (3D-footprint 20260701), 4x9j_A (3D-footprint 20260701) |
| Names: | AT225, Early growth response protein 1, EGR-1, EGR1_HUMAN, Nerve growth factor-induced protein A, NGFI-A, Transcription factor ETR103, Transcription factor Zif268, Zinc finger protein 225, Zinc finger protein Krox-24 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P18146 |
| Length: | 86 |
| Pfam Domains: | 4-28 Zinc finger, C2H2 type 4-28 C2H2-type zinc finger 21-44 Zinc-finger double domain 34-56 Zinc finger, C2H2 type 34-56 C2H2-type zinc finger 48-72 Zinc-finger double domain 62-84 Zinc finger, C2H2 type 62-80 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEK 60 61 PFACDICGRKFARSDERKRHTKIHLR |
| Interface Residues: | 16, 17, 18, 19, 20, 22, 23, 44, 45, 46, 47, 48, 50, 51, 52, 72, 73, 74, 75, 76, 77, 78, 79, 80 |
| 3D-footprint Homologues: | 7n5w_A, 6jnm_A, 1tf3_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 2wbs_A, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 2kmk_A, 7ysf_A, 6ml4_A, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 6a57_A, 7y3l_A, 3uk3_C, 8cuc_F, 7txc_E, 5k5i_A, 1llm_D, 2drp_D, 5yel_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D |
| Binding Motifs: | 4r2a_A GCGTGGGcg 4r2c_A GCGTGGGGt 4x9j_A annCCCAnnC |
| Binding Sites: | 4r2c_B 4r2a_C / 4r2c_C 4x9j_B 4x9j_C 4r2a_B |
| Publications: | Hashimoto H, Olanrewaju Y.O, Zheng Y, Wilson G.G, Zhang X, Cheng X. Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence. Genes & development 28:2304-13 (2014). [Pubmed] Zandarashvili L, White MA, Esadze A, Iwahara J. Structural impact of complete CpG methylation within target DNA on specific complex formation of the inducible transcription factor Egr-1. FEBS Lett 589:1748-53 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.