Transcription Factor
| Accessions: | E2F8_DBD (HumanTF 1.0), E2F8_TF2 (HumanTF2 1.0), E2F8 (HT-SELEX2 May2017) |
| Names: | E2F-8, E2F8, E2F8_HUMAN, Transcription factor E2F8, ENSG00000129173 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2, HT-SELEX2 May2017 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 3 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | A0AVK6 |
| Notes: | Ensembl ID: ENSG00000129173; DNA-binding domain sequence; TF family: E2F; Clone source: Gene synthesis, Ensembl ID: ENSG00000129173; Construct type: TF2(3xFLAG); TF family: E2F; Clone source: Jolma et al. 2013, TF family: E2F experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: E2F experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 262 |
| Pfam Domains: | 14-83 E2F/DP family winged-helix DNA-binding domain 162-248 E2F/DP family winged-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 HLSGDEFEKSQPSRKEKSLGLLCHKFLARYPNYPNPAVNNDICLDEVAEELNVERRRIYD 60 61 IVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEENKYAEQIMMIKKKEYEQEFD 120 121 FIKSYSIEDHIIKSNTGPNGHPDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLFLV 180 181 STPQIVSLEVAAKILIGEDHVEDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGR 240 241 KPAFKWTGPEISPNTSGSSPVI |
| Interface Residues: | 11, 12, 14, 52, 54, 55, 56, 57, 59, 211, 214, 215, 217 |
| 3D-footprint Homologues: | 6p7b_B, 1cf7_A, 4yo2_A, 1cf7_B |
| Binding Motifs: | E2F8_DBD TTTCCCGCCAAA GCM2_E2F8 ATrsGGGtwatsGcGGGAaw TFAP2C_E2F8 ttTCCCGCbmsCCcsmGGs E2F8_2 wtTTCCCGCCAaaw E2F8_methyl_1 wtTTCCCGCcAAaw |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.