Transcription Factor

Accessions: 1cjg_A (3D-footprint 20231221), 1cjg_B (3D-footprint 20231221)
Names: LAC REPRESSOR, LACI_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03023
Length: 62
Pfam Domains: 5-50 Bacterial regulatory proteins, lacI family
Sequence:
(in bold interface residues)
1 MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQ 60
61 SL
Interface Residues: 6, 7, 16, 17, 18, 19, 21, 22, 28, 29, 30, 53, 56, 57
3D-footprint Homologues: 7ce1_D, 1efa_B, 3oqm_C, 1l1m_B, 5ui5_I, 1zvv_A, 1jft_A, 4i2o_B
Binding Motifs: 1cjg_AB TgAGCGCTCA
1cjg_B TGAGC
Binding Sites: 1cjg_C / 1cjg_D
Publications: Spronk C.A, Bonvin A.M, Radha P.K, Melacini G, Boelens R, Kaptein R. The solution structure of Lac repressor headpiece 62 complexed to a symmetrical lac operator. Structure (London, England : 1993) 7:1483-92 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.