footprintDB - a database of transcription factors with annotated cis elements (DNA motifs and sites) and binding interfaces

Transcription Factor

Accessions:	B5KMS8 (JASPAR 2024)
Names:	B5KMS8_SOYBN, HAP3 protein, LEC1a, Transcription factor LEC1-A
Organisms:	Glycine max
Libraries:	JASPAR 2024 ¹ ¹ Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot:	B5KMS8
Length:	223
Pfam Domains:	62-126 Histone-like transcription factor (CBF/NF-Y) and archaeal histone 64-126 Core histone H2A/H2B/H3/H4
Sequence: (in bold interface residues)	1 METGGFHGYRKLPNTTSGLKLSVSDMNMNMRQQQVASSDQNCSNHSAAGEENECTVREQD 60 61 RFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAE 120 121 DVLWAMSKLGFDDYIEPLTMYLHRYRELEGDRTSMRGEPLGKRTVEYATLATAFVPPPFH 180 181 HHNGYFGAAMPMGTYVRETPPNAASSHHHHGISNAHEPNARSI
Interface Residues:	57, 58, 61, 62, 66, 81, 84, 151
3D-footprint Homologues:	2ypa_A, 4g92_B, 6r2v_B, 4awl_B, 8hr1_F, 3azk_F, 8t9f_F, 5mlu_F, 3w99_F, 5o9g_F, 7wlr_E, 5t5k_E, 7cvo_B, 1jfi_B
Binding Motifs:	UN0422.1 caCGTGGCAyw UN0423.1 daCAAGTGkm UN0424.1 wyAtGTGTCww UN0422.2 aCGTGGCA UN0423.2 CAAGTG UN0424.2 AtGTGTC
Binding Sites:	UN0423.2.7 UN0422.2.1 / UN0422.2.12 / UN0422.2.14 / UN0422.2.5 / UN0422.2.6 UN0422.2.11 / UN0422.2.7 UN0422.2.2 / UN0422.2.4 / UN0422.2.8 UN0422.2.10 / UN0422.2.13 / UN0422.2.18 UN0422.1.18 UN0422.1.12 / UN0422.1.15 UN0422.1.1 UN0422.1.6 / UN0422.1.8 UN0422.1.10 / UN0422.1.12 UN0422.1.11 / UN0422.1.14 UN0422.1.13 / UN0422.1.17 UN0422.1.14 / UN0422.1.19 UN0422.1.15 / UN0422.1.20 UN0422.1.16 UN0422.1.17 UN0422.1.19 UN0422.1.2 / UN0422.1.3 UN0422.1.20 UN0422.1.3 / UN0422.1.5 UN0422.1.4 / UN0422.1.6 UN0422.1.5 / UN0422.1.7 UN0422.1.7 / UN0422.1.9 UN0422.1.10 / UN0422.1.8 UN0422.1.11 / UN0422.1.9 UN0423.1.1 UN0423.1.10 UN0423.1.11 UN0423.1.12 UN0423.1.13 UN0423.1.14 UN0423.1.15 UN0423.1.16 / UN0423.1.20 UN0423.1.17 UN0423.1.18 UN0423.1.19 UN0423.1.2 UN0423.1.3 UN0423.1.13 / UN0423.1.4 UN0423.1.20 / UN0423.1.5 UN0423.1.6 UN0423.1.7 UN0423.1.8 UN0423.1.9 UN0424.1.1 UN0424.1.10 UN0424.1.11 UN0424.1.12 UN0424.1.13 UN0424.1.14 UN0424.1.15 UN0424.1.16 UN0424.1.17 UN0424.1.18 UN0424.1.19 UN0424.1.2 UN0424.1.20 UN0424.1.3 UN0424.1.4 / UN0424.1.7 UN0424.1.5 / UN0424.1.9 UN0424.1.15 / UN0424.1.6 UN0424.1.20 / UN0424.1.7 UN0424.1.8 UN0424.1.9 UN0424.2.1 / UN0424.2.13 / UN0424.2.14 / UN0424.2.16 / UN0424.2.2 / UN0424.2.4 UN0422.2.15 / UN0422.2.16 UN0422.1.4 UN0422.2.19 UN0422.2.17 UN0422.1.13 UN0422.1.16 UN0422.1.18 UN0422.1.2 UN0422.2.20 UN0422.2.3 UN0422.2.9 UN0423.1.10 UN0423.1.11 UN0423.1.12 UN0423.1.14 / UN0423.1.15 UN0423.1.16 UN0423.1.17 UN0423.1.18 UN0423.1.19 UN0423.1.4 UN0423.1.5 UN0423.1.6 UN0423.1.7 UN0423.1.8 UN0423.1.9 UN0423.2.1 / UN0423.2.10 / UN0423.2.11 / UN0423.2.13 / UN0423.2.14 / UN0423.2.15 / UN0423.2.16 / UN0423.2.17 / UN0423.2.18 / UN0423.2.19 / UN0423.2.2 / UN0423.2.20 / UN0423.2.3 / UN0423.2.4 / UN0423.2.5 / UN0423.2.6 / UN0423.2.8 / UN0423.2.9 UN0423.2.12 UN0424.1.10 UN0424.1.11 UN0424.1.12 UN0424.1.13 UN0424.1.14 UN0424.1.16 UN0424.1.17 UN0424.1.18 UN0424.1.19 UN0424.1.4 UN0424.1.5 UN0424.1.6 UN0424.1.8 UN0424.2.10 / UN0424.2.15 / UN0424.2.19 UN0424.2.11 / UN0424.2.6 UN0424.2.12 UN0424.2.17 UN0424.2.18 / UN0424.2.3 UN0424.2.20 UN0424.2.5 UN0424.2.7 UN0424.2.8 UN0424.2.9
Related annotations:	PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.

User:
Password:
	Register