Transcription Factor
| Accessions: | DREB1B (Athamap 20091028), P93835 (JASPAR 2024), T18160 (AthalianaCistrome v4_May2016) |
| Names: | C-repeat-binding factor 1, C-repeat/dehydration-responsive element-binding factor 1, CBF1, CRT/DRE-binding factor 1, Dehydration-responsive element-binding protein 1B, DREB1B, Protein DREB1B, DRE1B_ARATH, AT4G25490, T18160; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | Athamap 20091028 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Uniprot: | P93835 |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP |
| Length: | 213 |
| Pfam Domains: | 47-96 AP2 domain |
| Sequence: (in bold interface residues) | 1 MNSFSAFSEMFGSDYEPQGGDYCPTLATSCPKKPAGRKKFRETRHPIYRGVRQRNSGKWV 60 61 SEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFADSAWRLRIPESTCAKD 120 121 IQKAAAEAALAFQDETCDTTTTNHGLDMEETMVEAIYTPEQSEGAFYMDEETMFGMPTLL 180 181 DNMAEGMLLPPPSVQWNHNYDGEGDGDVSLWSY |
| Interface Residues: | 52, 53, 54, 55, 56, 60, 62, 64, 71, 73 |
| 3D-footprint Homologues: | 5wx9_A, 1gcc_A, 7wq5_A |
| Binding Motifs: | DREB1B AykrCCGACmT M0042 / MA1224.1 kyyrCCGACatm M0023 hkaTGTCGGyrrard MA1669.1 wyyRCCGACATmrw MA1669.2 RCCGACAT |
| Binding Sites: | DREB1B_1 DREB1B_3 DREB1B_2 MA1669.2.10 / MA1669.2.11 / MA1669.2.12 / MA1669.2.15 / MA1669.2.16 / MA1669.2.18 / MA1669.2.20 / MA1669.2.3 / MA1669.2.4 / MA1669.2.7 / MA1669.2.8 MA1669.2.5 MA1669.2.2 MA1224.1.1 MA1224.1.10 MA1224.1.11 MA1224.1.12 MA1224.1.13 MA1224.1.14 MA1224.1.15 MA1224.1.16 MA1224.1.17 MA1224.1.18 MA1224.1.19 MA1224.1.2 MA1224.1.20 MA1224.1.3 MA1224.1.4 / MA1224.1.5 MA1224.1.6 MA1224.1.7 MA1224.1.8 MA1224.1.9 MA1669.1.1 MA1669.1.10 / MA1669.1.8 MA1669.1.11 / MA1669.1.9 MA1669.1.10 / MA1669.1.12 MA1669.1.11 / MA1669.1.13 MA1669.1.12 / MA1669.1.14 MA1669.1.13 / MA1669.1.15 MA1669.1.14 / MA1669.1.16 MA1669.1.15 / MA1669.1.17 MA1669.1.16 / MA1669.1.18 MA1669.1.19 MA1669.1.1 / MA1669.1.2 MA1669.1.20 MA1669.1.2 / MA1669.1.3 MA1669.1.3 / MA1669.1.4 MA1669.1.4 / MA1669.1.5 MA1669.1.6 MA1669.1.5 / MA1669.1.7 MA1669.1.8 MA1669.1.7 / MA1669.1.9 MA1669.1.17 MA1669.1.18 MA1669.1.19 MA1669.1.20 MA1669.1.6 MA1669.2.1 MA1669.2.13 / MA1669.2.17 MA1669.2.14 / MA1669.2.19 MA1669.2.6 MA1669.2.9 |
| Publications: | Gilmour SJ, Zarka DG, Stockinger EJ, Salazar MP, Houghton JM, Thomashow MF. 1998. Low temperature regulation of the Arabidopsis CBF family of AP2 transcriptional activators as an early step in cold-induced COR gene expression. Plant J. 16:433-42. [Pubmed] Stockinger EJ, Gilmour SJ, Thomashow MF. 1997. Arabidopsis thaliana CBF1 encodes an AP2 domain-containing transcriptional activator that binds to the C-repeat/DRE, a cis-acting DNA regulatory element that stimulates transcription in response to low temperature and water deficit. Proc Natl Acad Sci U S A. 94:1035-40. [Pubmed] Kim M. J., Lee T. H., Pahk Y. M., Kim Y. H., Park H. M., Choi Y. D., Nahm B. H., Kim Y. K. Quadruple 9-mer-based protein binding microarray with DsRed fusion protein.. BMC Mol. Biol. 10:91 (2009). [Pubmed] Medina J, Bargues M, Terol J, Pérez-Alonso M, Salinas J. The Arabidopsis CBF gene family is composed of three genes encoding AP2 domain-containing proteins whose expression Is regulated by low temperature but not by abscisic acid or dehydration. Plant Physiol 119:463-70 (1999). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.