Transcription Factor
| Accessions: | 5yi3_I (3D-footprint 20231221) |
| Names: | Q9CDU5_LACLA, Zinc transport transcriptional regulator |
| Organisms: | Lactococcus lactis, Lactococcus lactis subsp. lactis (strain IL1403) |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 145 |
| Pfam Domains: | 35-90 MarR family 35-92 MarR family 36-81 Winged helix-turn-helix DNA-binding 36-99 Winged helix DNA-binding domain 41-82 Bacterial regulatory protein, arsR family 41-84 Transcriptional regulator 42-81 Iron dependent repressor, N-terminal DNA binding domain 42-114 TFIIE alpha subunit |
| Sequence: (in bold interface residues) | 1 MSLANQIDQFLGTIMQFAENKHEILLGKSESDVKLTSTQEHILMLLAEQISTNAKIAEKL 60 61 KISPAAVTKALKKLQEQELIKSSRATNDERVVLWSLTEKAVPVAKEHATHHEKTLSTYQE 120 121 LGNKFTDEEQEVISKFLSALTEEFQ |
| Interface Residues: | 36, 38, 53, 63, 64, 65, 66, 68, 69, 70, 73, 90 |
| 3D-footprint Homologues: | 4kdp_B, 7el3_B, 5yi2_J, 6c2s_C, 1z9c_A, 6jbx_A, 3q5f_A, 3zpl_B, 8c7s_A, 4aik_A, 5hlg_E |
| Binding Motifs: | 5yi3_I TTAACT |
| Binding Sites: | 5yi3_K / 5yi3_L |
| Publications: | Zhu R, Song Y, Liu H, Yang Y, Wang S, Yi C, Chen PR. Allosteric histidine switch for regulation of intracellular zinc(II) fluctuation. Proc Natl Acad Sci U S A 114:13661-13666 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.