Transcription Factor

Accessions: 3q5f_B (3D-footprint 20231221)
Names: Cytolysin SlyA, Salmolysin, SLYA_SALTY, Transcriptional regulator slyA
Organisms: Salmonella enterica subsp. enterica serovar Typhimurium, strain LT2 / SGSC1412 / ATCC 700720
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P40676
Length: 140
Pfam Domains: 26-85 MarR family
27-85 MarR family
27-93 Winged helix DNA-binding domain
Sequence:
(in bold interface residues)
1 SPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPS 60
61 LVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEE 120
121 IELLIKLIAKLEHNIMELHS
Interface Residues: 47, 57, 58, 59, 60, 62, 63, 64, 66, 67, 84
3D-footprint Homologues: 7el3_B, 3q5f_A, 5yi2_J, 7bhy_A, 5h3r_A, 1z9c_A, 6c2s_C, 3iyd_H, 6jbx_A, 6q2b_B, 4kdp_B, 3zpl_B, 4aik_A, 5hlg_E, 4fx4_B, 5hso_A, 7dvv_A
Binding Motifs: 3q5f_AB TAnntTAGCAAGCTAAnnAT
Binding Sites: 3q5f_C
3q5f_D
Publications: Dolan K.T, Duguid E.M, He C. Crystal structures of SlyA protein, a master virulence regulator of Salmonella, in free and DNA-bound states. The Journal of biological chemistry 286:22178-85 (2011). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.