Transcription Factor
| Accessions: | IRF7_DBD (HumanTF 1.0), IRF7 (HT-SELEX2 May2017) |
| Names: | Interferon regulatory factor 7, IRF-7, IRF7, IRF7_HUMAN, ENSG00000185507 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q92985 |
| Notes: | Ensembl ID: ENSG00000185507; DNA-binding domain sequence; TF family: IRF; Clone source: Megaman, TF family: IRF experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: IRF experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 141 |
| Pfam Domains: | 9-124 Interferon regulatory factor transcription factor |
| Sequence: (in bold interface residues) | 1 LAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKA 60 61 WAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVY 120 121 ALSRELCWREGPGTDQTEAEA |
| Interface Residues: | 44, 46, 82, 91, 92, 94, 95, 98, 99 |
| 3D-footprint Homologues: | 2pi0_B, 1if1_B, 2irf_L, 2o61_A, 7oot_B |
| Binding Motifs: | IRF7_DBD_1 mCGAAAryGAAAvT IRF7_DBD_2 rAAwCGAAAwTCGwTTy IRF7_2 mCGAAAvYGAAAvya IRF7_methyl_1 wgGAAArTGAAAgtr |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.