Transcription Factor
| Accessions: | GLI3_TF1 (HumanTF2 1.0), GLI3_TF2 (HumanTF2 1.0), GLI3 (HT-SELEX2 May2017) |
| Names: | GLI3, GLI3 C-terminally truncated form, GLI3 form of 190 kDa, GLI3 form of 83 kDa, GLI3 full length protein, GLI3_HUMAN, GLI3-190, GLI3-83, GLI3FL, Transcriptional activator GLI3, ENSG00000106571 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P10071 |
| Notes: | Ensembl ID: ENSG00000106571; Construct type: TF1(SBP); TF family: znfC2H2; Clone source: Gene synthesis, Ensembl ID: ENSG00000106571; Construct type: TF2(3xFLAG); TF family: znfC2H2; Clone source: Gene synthesis, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 198 |
| Pfam Domains: | 23-46 C2H2-type zinc finger 54-81 Zinc finger, C2H2 type 74-99 Zinc-finger double domain 87-111 C2H2-type zinc finger 87-111 Zinc finger, C2H2 type 103-130 Zinc-finger double domain 117-142 C2H2-type zinc finger 117-142 Zinc finger, C2H2 type 136-160 Zinc-finger double domain 148-173 C2H2-type zinc finger 148-173 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 LVKEEGDKDESKQEPEVIYETNCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLD 60 61 CSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCE 120 121 HEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVT 180 181 KKQRGDIHPRPPPPRDSG |
| Interface Residues: | 33, 34, 35, 36, 37, 40, 59, 69, 70, 71, 72, 73, 75, 76, 78, 79, 82, 99, 100, 102, 103, 105, 106, 129, 130, 131, 132, 133, 134, 135, 136, 137, 140, 161, 162, 163, 164, 165, 166, 167, 168 |
| 3D-footprint Homologues: | 7w1m_H, 5v3j_F, 1ubd_C, 2kmk_A, 7y3l_A, 1tf3_A, 6jnm_A, 3uk3_C, 6blw_A, 8cuc_F, 2gli_A, 1tf6_A, 5ei9_F, 6ml4_A, 5k5i_A, 6e94_A, 6a57_A, 2jpa_A, 5kkq_D, 8ssq_A, 8ssu_A, 8h9h_G, 7n5w_A, 5yj3_D, 4x9j_A, 1f2i_J, 5kl3_A, 7txc_E, 1g2f_F, 7ysf_A, 1llm_D, 6u9q_A, 5yel_A, 2lt7_A, 7y3m_I, 2wbs_A, 2drp_D, 4m9v_C |
| Binding Motifs: | GLI3 rGACCACCCACGwyG GLI3_2 vGACCACCCACgwcG GLI3_methyl_1 rGACCACCCACrwwG |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.