Transcription Factor

Accessions: GLI3_TF1 (HumanTF2 1.0), GLI3_TF2 (HumanTF2 1.0), GLI3 (HT-SELEX2 May2017)
Names: GLI3, GLI3 C-terminally truncated form, GLI3 form of 190 kDa, GLI3 form of 83 kDa, GLI3 full length protein, GLI3_HUMAN, GLI3-190, GLI3-83, GLI3FL, Transcriptional activator GLI3, ENSG00000106571
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: P10071
Notes: Ensembl ID: ENSG00000106571; Construct type: TF1(SBP); TF family: znfC2H2; Clone source: Gene synthesis, Ensembl ID: ENSG00000106571; Construct type: TF2(3xFLAG); TF family: znfC2H2; Clone source: Gene synthesis, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2
Length: 198
Pfam Domains: 23-46 C2H2-type zinc finger
54-81 Zinc finger, C2H2 type
74-99 Zinc-finger double domain
87-111 C2H2-type zinc finger
87-111 Zinc finger, C2H2 type
103-130 Zinc-finger double domain
117-142 C2H2-type zinc finger
117-142 Zinc finger, C2H2 type
136-160 Zinc-finger double domain
148-173 C2H2-type zinc finger
148-173 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 LVKEEGDKDESKQEPEVIYETNCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLD 60
61 CSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCE 120
121 HEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVT 180
181 KKQRGDIHPRPPPPRDSG
Interface Residues: 33, 34, 35, 36, 37, 40, 59, 69, 70, 71, 72, 73, 75, 76, 78, 79, 82, 99, 100, 102, 103, 105, 106, 129, 130, 131, 132, 133, 134, 135, 136, 137, 140, 161, 162, 163, 164, 165, 166, 167, 168
3D-footprint Homologues: 7w1m_H, 5v3j_F, 1ubd_C, 2kmk_A, 7y3l_A, 1tf3_A, 6jnm_A, 3uk3_C, 6blw_A, 8cuc_F, 2gli_A, 1tf6_A, 5ei9_F, 6ml4_A, 5k5i_A, 6e94_A, 6a57_A, 2jpa_A, 5kkq_D, 8ssq_A, 8ssu_A, 8h9h_G, 7n5w_A, 5yj3_D, 4x9j_A, 1f2i_J, 5kl3_A, 7txc_E, 1g2f_F, 7ysf_A, 1llm_D, 6u9q_A, 5yel_A, 2lt7_A, 7y3m_I, 2wbs_A, 2drp_D, 4m9v_C
Binding Motifs: GLI3 rGACCACCCACGwyG
GLI3_2 vGACCACCCACgwcG
GLI3_methyl_1 rGACCACCCACrwwG
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.