Transcription Factor

						

			
Accessions: T10979 (AthalianaCistrome v4_May2016), A8MQN6 (JASPAR 2024)

			
Names: AT2G01818, T10979;, A8MQN6_ARATH
Organisms: Arabidopsis thaliana
Libraries: AthalianaCistrome v4_May2016 1, JASPAR 2024 2
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]

2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:PLATZ
Length: 222
Pfam Domains:    70-146 PLATZ transcription factor
Sequence: MNLSEKRRSEEVWIETLLNSEFFGICMNHKYLRKNEKNVFCIDCNVEICRHCCNTVTDSH
FLHRRLQICKYVYQDVIRLLEIQNYFDCSEIQTYKINGEKAIHLNSRPQAKDARPSTKAK
NGASCVTCKRYIQDHPNLFCSISCKISTPSKKHKFCFSPKLEQSVLEKEHSTQEGSLEEK
KSCTSSLTDVSEDSEVLLSDFSFRPLLRILKRKGISRRSPFY
Binding Motifs: M0721 rGAAgmTTCTAGAAg
UN0394.1 rGAAgmTTCTAGAAg
UN0394.2 rGAAgmTTCTAGAA
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.