Transcription Factor

Accessions: 4hn6_A (3D-footprint 20250804), 4hn6_B (3D-footprint 20250804)
Names: GCR_HUMAN, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P04150
Length: 72
Pfam Domains: 1-69 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGDNRCIIDKIRRKNCPACRY 60
61 RKCLQAGMNLEA
Interface Residues: 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E
Binding Motifs: 4hn6_AB CTcTnCcnnnnGCG
Binding Sites: 4hn6_C
4hn6_D
Publications: Hudson W.H, Youn C, Ortlund E.A. The structural basis of direct glucocorticoid-mediated transrepression. Nature structural & molecular biology 20:53-8 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.