Transcription Factor

						

			
Accessions: 1p47_A (3D-footprint 20231221), 4r2d_A (3D-footprint 20231221)

			
Names: Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, Transcription factor Zif268, Zinc finger protein Krox-24, AT225, EGR1_HUMAN, Transcription factor ETR103, Zinc finger protein 225
Organisms: Mus musculus, Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08046
Length: 87
Pfam Domains:      4-28 C2H2-type zinc finger
     4-28 Zinc finger, C2H2 type
    21-44 Zinc-finger double domain
    34-56 Zinc finger, C2H2 type
    34-56 C2H2-type zinc finger
    48-72 Zinc-finger double domain
    62-84 Zinc finger, C2H2 type
    62-80 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEK   60
  61 PFACDICGRKFARSDERKRHTKIHLRQ
Interface Residues: 16, 17, 18, 19, 20, 22, 23, 42, 44, 45, 46, 47, 48, 50, 51, 52, 72, 73, 74, 75, 76, 77, 78, 79, 80
3D-footprint Homologues: 1tf3_A, 6jnm_A, 7n5w_A, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 5k5l_F, 8ssu_A, 1tf6_A, 6ml4_A, 4x9j_A, 2i13_A, 6blw_A, 5kkq_D, 2wbs_A, 1ubd_C, 6u9q_A, 5ei9_F, 2jpa_A, 1mey_C, 5kl3_A, 7ysf_A, 1f2i_J, 6wmi_A, 7eyi_G, 5v3j_F, 8h9h_G, 2lt7_A, 6e94_A, 6a57_A, 2drp_D, 8cuc_F, 7y3l_A, 3uk3_C, 1llm_D, 5yel_A, 7txc_E, 5k5i_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: 1p47_AB GGCGTGGGCGGCGTGGGCGT
4r2d_A AGCCCACGC
Binding Sites: 4r2d_B
4r2d_C
			
Publications: Peisach E, Pabo C.O. Constraints for zinc finger linker design as inferred from X-ray crystal structure of tandem Zif268-DNA complexes. Journal of molecular biology 330:1-7 (2003). [Pubmed]


Hashimoto H, Olanrewaju Y.O, Zheng Y, Wilson G.G, Zhang X, Cheng X. Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence. Genes & development 28:2304-13 (2014). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.