Transcription Factor
Accessions: | 5ybd_A (3D-footprint 20231221) |
Names: | ERG_HUMAN, Transcriptional regulator ERG, Transforming protein ERG |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P11308 |
Length: | 96 |
Pfam Domains: | 1-82 Ets-domain |
Sequence: (in bold interface residues) | 1 IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALR 60 61 YYYDKNIMTKVHGKRYAYKFDFHGIAQALLEHHHHH |
Interface Residues: | 53, 54, 56, 57, 58, 60, 61, 75 |
3D-footprint Homologues: | 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A |
Binding Motifs: | 5ybd_A tTCCg |
Binding Sites: | 5ybd_B 5ybd_C |
Publications: | Sharma R, Gangwar SP, Saxena AK. Comparative structure analysis of the ETSi domain of ERG3 and its complex with the E74 promoter DNA sequence. Acta Crystallogr F Struct Biol Commun : (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.