Transcription Factor

Accessions: 5ybd_A (3D-footprint 20231221)
Names: ERG_HUMAN, Transcriptional regulator ERG, Transforming protein ERG
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P11308
Length: 96
Pfam Domains: 1-82 Ets-domain
Sequence:
(in bold interface residues)
1 IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALR 60
61 YYYDKNIMTKVHGKRYAYKFDFHGIAQALLEHHHHH
Interface Residues: 53, 54, 56, 57, 58, 60, 61, 75
3D-footprint Homologues: 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A
Binding Motifs: 5ybd_A tTCCg
Binding Sites: 5ybd_B
5ybd_C
Publications: Sharma R, Gangwar SP, Saxena AK. Comparative structure analysis of the ETSi domain of ERG3 and its complex with the E74 promoter DNA sequence. Acta Crystallogr F Struct Biol Commun : (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.