Transcription Factor

Accessions: 2it0_C (3D-footprint 20231221), 2it0_D (3D-footprint 20231221)
Names: IDER_MYCTU, Iron-dependent repressor ideR
Organisms: Mycobacterium tuberculosis, strain ATCC 25618 / H37Rv
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P9WMH0
Length: 137
Pfam Domains: 1-60 Iron dependent repressor, N-terminal DNA binding domain
9-66 Winged helix DNA-binding domain
63-132 Iron dependent repressor, metal binding and dimerisation domain
Sequence:
(in bold interface residues)
1 ELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHL 60
61 ELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNN 120
121 PTTSPFGNPIPGLVELG
Interface Residues: 35, 36, 37, 38, 40, 41, 42, 45, 53, 55, 56
3D-footprint Homologues: 4lln_I, 2isz_B, 6jbx_A, 1ddn_B, 7b24_C, 1f5t_A, 4hf1_A, 1u8r_B, 4fx4_B
Binding Motifs: 2it0_ABCD AGGGnAGCCTnnGCT
Binding Sites: 2it0_E
2it0_F
Publications: Wisedchaisri G, Chou C.J, Wu M, Roach C, Rice A.E, Holmes R.K, Beeson C, Hol W.G. Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis. Biochemistry 46:436-47 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.