Transcription Factor
| Accessions: | 5krb_G (3D-footprint 20231221) |
| Names: | GCNF, Germ cell nuclear factor, mGCNF, NR6A1_MOUSE, Nuclear receptor subfamily 6 group A member 1, Retinoid receptor-related testis-specific receptor, RTR |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q64249 |
| Length: | 82 |
| Pfam Domains: | 1-69 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 TCLICGDRATGLHYGIISCEGCKGFFKRSISNKRVYRCSRDKNCVMSRKQRNRCQYCRLL 60 61 KCLQMGMNRKAIREDGMPGGRN |
| Interface Residues: | 10, 11, 13, 14, 20, 21, 23, 24, 27, 28, 52, 65, 78, 81 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xv6_B, 5emc_A, 5cbx_B, 3g6t_A, 1r4i_A, 7prw_B, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 6i52_C |
| Binding Motifs: | 5krb_BG GGTCAaGGnCA 5krb_G TcnaGGnCA |
| Binding Sites: | 5krb_A 5krb_E |
| Publications: | Weikum ER, Tuntland ML, Murphy MN, Ortlund EA. A Structural Investigation into Oct4 Regulation by Orphan Nuclear Receptors, Germ Cell Nuclear Factor (GCNF), and Liver Receptor Homolog-1 (LRH-1). J Mol Biol : (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.