Transcription Factor

						

			
Accessions: ATF4_DBD (HumanTF 1.0), ATF4_TF1 (HumanTF2 1.0), ATF4_TF2 (HumanTF2 1.0)

			
Names: Activating transcription factor 4, ATF4, ATF4_HUMAN, cAMP-dependent transcription factor ATF-4, cAMP-responsive element-binding protein 2, CREB-2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2, DNA-binding protein TAXREB67, Tax-responsive enhancer element-binding protein 67
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: P18848
Notes: Ensembl ID: ENSG00000128272; DNA-binding domain sequence; TF family: bZIP; Clone source: MGC, Ensembl ID: ENSG00000128272; Construct type: TF1(SBP); TF family: bZIP; Clone source: Jolma et al. 2013, Ensembl ID: ENSG00000128272; Construct type: TF2(3xFLAG); TF family: bZIP; Clone source: Jolma et al. 2013
Length: 98
Pfam Domains:     23-84 bZIP transcription factor
    26-77 Basic region leucine zipper
Sequence: 
(in bold interface residues)		   1 MAARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKEL   60
  61 EKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Interface Residues: 35, 36, 38, 39, 42, 43
3D-footprint Homologues: 2wt7_A, 6mg1_B
Binding Motifs: ATF4_DBD ggaTGAyGCAAYm
ATF4_CEBPB ggrTGAyGCAAym
ATF4_CEBPD rgaTGAyGCAAyms
ATF4_TEF rkmTGAYGCAATm
CEBPG_ATF4 rgATGAYGCAAT
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]


Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.