Transcription Factor

Accessions: ATF4_DBD (HumanTF 1.0), ATF4_TF1 (HumanTF2 1.0), ATF4_TF2 (HumanTF2 1.0)
Names: Activating transcription factor 4, ATF4, ATF4_HUMAN, cAMP-dependent transcription factor ATF-4, cAMP-responsive element-binding protein 2, CREB-2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2, DNA-binding protein TAXREB67, Tax-responsive enhancer element-binding protein 67
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: P18848
Notes: Ensembl ID: ENSG00000128272; DNA-binding domain sequence; TF family: bZIP; Clone source: MGC, Ensembl ID: ENSG00000128272; Construct type: TF1(SBP); TF family: bZIP; Clone source: Jolma et al. 2013, Ensembl ID: ENSG00000128272; Construct type: TF2(3xFLAG); TF family: bZIP; Clone source: Jolma et al. 2013
Length: 98
Pfam Domains: 23-84 bZIP transcription factor
26-77 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 MAARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKEL 60
61 EKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Interface Residues: 14, 18, 28, 30, 32, 34, 41, 43, 68, 70, 72, 73, 78
3D-footprint Homologues: 1s40_A, 6x1j_A
Binding Motifs: ATF4_DBD ggaTGAyGCAAYm
ATF4_CEBPB ggrTGAyGCAAym
ATF4_CEBPD rgaTGAyGCAAyms
ATF4_TEF rkmTGAYGCAATm
CEBPG_ATF4 rgATGAYGCAAT
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.