Transcription Factor

Accessions: 1b8i_B (3D-footprint 20241219)
Names: Dpbx, EXD_DROME, HOMEOBOX PROTEIN EXTRADENTICLE
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P40427
Length: 58
Pfam Domains: 1-57 Homeobox domain
16-54 Homeobox KN domain
Sequence:
(in bold interface residues)
1 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKN
Interface Residues: 1, 2, 4, 42, 43, 45, 46, 49, 50, 52, 53, 54, 57
3D-footprint Homologues: 9b8u_A, 8ejp_B, 2lkx_A, 2ld5_A, 8ik5_C, 8osb_E, 8pi8_B, 7q3o_C, 6es3_K, 1zq3_P, 8pmf_A, 8bx1_A, 6m3d_C, 2d5v_B, 7psx_B, 2hdd_A, 8eml_B, 4cyc_A, 8g87_X, 2hos_A
Binding Motifs: 1b8i_AB GTGATTTATGG
1b8i_B gTGAt
Binding Sites: 1b8i_C
1b8i_D
Publications: Passner J.M, Ryoo H.D, Shen L, Mann R.S, Aggarwal A.K. Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex. Nature 397:714-9 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.