Transcription Factor

Accessions: 4pu3_C (3D-footprint 20250804), 4pu3_D (3D-footprint 20250804)
Names: HIPB_SHEON, Toxin-antitoxin system antidote transcriptional repressor Xre family
Organisms: Shewanella oneidensis, strain MR-1
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8EIX4
Length: 71
Pfam Domains: 11-64 Helix-turn-helix domain
14-65 Helix-turn-helix domain
15-65 Helix-turn-helix
Sequence:
(in bold interface residues)
1 IMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDG 60
61 LGIDIVSAGWY
Interface Residues: 26, 27, 36, 37, 38, 39, 41, 42, 48, 50
3D-footprint Homologues: 3cro_R, 4pu3_C, 5jub_B
Binding Motifs: 4pu3_ABCD AGGnTnnnnnnCTnA
4pu3_C AncCt
Binding Sites: 4pu3_P
4pu3_Q
Publications: Wen Y, Behiels E, Felix J, Elegheert J, Vergauwen B, Devreese B, Savvides S.N. The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence. Nucleic acids research 42:10134-47 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.