Transcription Factor
| Accessions: | 4pu3_C (3D-footprint 20250804), 4pu3_D (3D-footprint 20250804) |
| Names: | HIPB_SHEON, Toxin-antitoxin system antidote transcriptional repressor Xre family |
| Organisms: | Shewanella oneidensis, strain MR-1 |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q8EIX4 |
| Length: | 71 |
| Pfam Domains: | 11-64 Helix-turn-helix domain 14-65 Helix-turn-helix domain 15-65 Helix-turn-helix |
| Sequence: (in bold interface residues) | 1 IMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDG 60 61 LGIDIVSAGWY |
| Interface Residues: | 26, 27, 36, 37, 38, 39, 41, 42, 48, 50 |
| 3D-footprint Homologues: | 4pu3_C, 3cro_R, 5jub_B |
| Binding Motifs: | 4pu3_ABCD AGGnTnnnnnnCTnA 4pu3_C AncCt |
| Binding Sites: | 4pu3_P 4pu3_Q |
| Publications: | Wen Y, Behiels E, Felix J, Elegheert J, Vergauwen B, Devreese B, Savvides S.N. The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence. Nucleic acids research 42:10134-47 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.