Transcription Factor

Accessions: 1a1l_A (3D-footprint 20250804), 1aay_A (3D-footprint 20250804), 1zaa_C (3D-footprint 20250804)
Names: Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, Transcription factor Zif268, ZIF268 ZINC FINGER PEPTIDE, Zinc finger protein Krox-24, ZIF268
Organisms: Mus musculus
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08046
Length: 85
Pfam Domains: 3-27 C2H2-type zinc finger
3-27 Zinc finger, C2H2 type
20-43 Zinc-finger double domain
33-55 C2H2-type zinc finger
33-55 Zinc finger, C2H2 type
47-71 Zinc-finger double domain
61-79 C2H2-type zinc finger
61-83 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKP 60
61 FACDICGRKFARSDERKRHTKIHLR
Interface Residues: 15, 16, 17, 18, 19, 21, 22, 43, 44, 45, 46, 47, 49, 50, 51, 71, 72, 73, 74, 75, 76, 77, 78, 79
3D-footprint Homologues: 1tf3_A, 7n5w_A, 6jnm_A, 2kmk_A, 7ysf_A, 6ml4_A, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 5v3j_F, 8h9h_G, 2lt7_A, 6e94_A, 6a57_A, 8cuc_F, 7y3l_A, 3uk3_C, 1llm_D, 2drp_D, 5yel_A, 2wbs_A, 7txc_E, 5k5i_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: 1a1l_A GCCCaCGC
1aay_A aCGCCCaCGC
1zaa_C ACGCCCACGC
Binding Sites: 1aay_B / 1zaa_A
1aay_C / 1zaa_B
1a1l_B
1a1l_C
Publications: Elrod-Erickson M, Benson T.E, Pabo C.O. High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition. Structure (London, England : 1993) 6:451-64 (1998). [Pubmed]

Elrod-Erickson M, Rould M.A, Nekludova L, Pabo C.O. Zif268 protein-DNA complex refined at 1.6 A: a model system for understanding zinc finger-DNA interactions. Structure (London, England : 1993) 4:1171-80 (1996). [Pubmed]

Pavletich N. P., Pablo C. O. Zinc finger-DNA recognition: Crystal structure of a Zif268-DNA complex at 2.1 A. Science 252:809-816 (1991). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.