Transcription Factor
Accessions: | 1a1l_A (3D-footprint 20241219), 1aay_A (3D-footprint 20241219), 1zaa_C (3D-footprint 20241219) |
Names: | Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, Transcription factor Zif268, ZIF268 ZINC FINGER PEPTIDE, Zinc finger protein Krox-24, ZIF268 |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P08046 |
Length: | 85 |
Pfam Domains: | 3-27 Zinc finger, C2H2 type 3-27 C2H2-type zinc finger 20-43 Zinc-finger double domain 33-55 Zinc finger, C2H2 type 33-55 C2H2-type zinc finger 47-71 Zinc-finger double domain 61-83 Zinc finger, C2H2 type 61-79 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKP 60 61 FACDICGRKFARSDERKRHTKIHLR |
Interface Residues: | 15, 16, 17, 18, 19, 21, 22, 43, 44, 45, 46, 47, 49, 50, 71, 72, 73, 74, 75, 77, 78 |
3D-footprint Homologues: | 1tf3_A, 7n5w_A, 8ssu_A, 2gli_A, 1tf6_A, 2jpa_A, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 2kmk_A, 6u9q_A, 5v3j_F, 8h9h_G, 2lt7_A, 6e94_A, 7y3l_A, 8cuc_F, 7txc_E, 2drp_D, 7y3m_I, 8gn3_A |
Binding Motifs: | 1a1l_A GCCCaCGC 1aay_A aCGCCCaCGC 1zaa_C ACGCCCACGC |
Binding Sites: | 1aay_B / 1zaa_A 1aay_C / 1zaa_B 1a1l_B 1a1l_C |
Publications: | Elrod-Erickson M, Benson T.E, Pabo C.O. High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition. Structure (London, England : 1993) 6:451-64 (1998). [Pubmed] Elrod-Erickson M, Rould M.A, Nekludova L, Pabo C.O. Zif268 protein-DNA complex refined at 1.6 A: a model system for understanding zinc finger-DNA interactions. Structure (London, England : 1993) 4:1171-80 (1996). [Pubmed] Pavletich N. P., Pablo C. O. Zinc finger-DNA recognition: Crystal structure of a Zif268-DNA complex at 2.1 A. Science 252:809-816 (1991). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.