Transcription Factor
Accessions: | 3f27_D (3D-footprint 20241219) |
Names: | SOX17_MOUSE, Transcription factor SOX-17 |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q61473 |
Length: | 74 |
Pfam Domains: | 1-69 HMG (high mobility group) box 2-64 Domain of unknown function (DUF1898) |
Sequence: (in bold interface residues) | 1 IRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQ 60 61 HMQDHPNYKYRPRR |
Interface Residues: | 3, 6, 8, 9, 12, 16, 27, 28, 29, 32, 70 |
3D-footprint Homologues: | 7m5w_A, 2gzk_A, 2lef_A |
Binding Motifs: | 3f27_D ACAATa |
Binding Sites: | 3f27_A 3f27_B |
Publications: | Palasingam P, Jauch R, Ng C.K, Kolatkar P.R. The structure of Sox17 bound to DNA reveals a conserved bending topology but selective protein interaction platforms. Journal of molecular biology 388:619-30 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.