Transcription Factor

						

			
Accessions: 3f27_D (3D-footprint 20231221)

			
Names: SOX17_MOUSE, Transcription factor SOX-17
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q61473
Length: 74
Pfam Domains:      1-69 HMG (high mobility group) box
     2-64 Domain of unknown function (DUF1898)
Sequence: 
(in bold interface residues)		   1 IRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQ   60
  61 HMQDHPNYKYRPRR
Interface Residues: 3, 6, 8, 9, 12, 16, 27, 28, 29, 32, 70, 74
3D-footprint Homologues: 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 7m5w_A, 3f27_D, 4s2q_D, 1qrv_A, 3tmm_A, 3tq6_B, 1hry_A
Binding Motifs: 3f27_D ACAATa
Binding Sites: 3f27_A
3f27_B
			
Publications: Palasingam P, Jauch R, Ng C.K, Kolatkar P.R. The structure of Sox17 bound to DNA reveals a conserved bending topology but selective protein interaction platforms. Journal of molecular biology 388:619-30 (2009). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.