Transcription Factor

						

			
Accessions: 4xrm_B (3D-footprint 20231221)

			
Names: Homeobox protein Meis2, Meis1-related protein 1, MEIS2_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O14770
Length: 64
Pfam Domains:     16-55 Homeobox KN domain
    18-55 Homeobox domain
Sequence: 
(in bold interface residues)		   1 SMGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM   60
  61 IDQS
Interface Residues: 46, 47, 50, 51, 52, 54, 55
3D-footprint Homologues: 7q3o_C, 4j19_B, 1le8_A, 1au7_A, 3lnq_A, 1le8_B, 6fqq_E, 4xrs_G, 2lkx_A, 1fjl_B, 6a8r_A, 3rkq_B, 1mnm_C, 5flv_I, 3cmy_A, 1k61_B, 6es3_K, 1puf_B, 8g87_X, 5hod_A, 3l1p_A, 6fqp_B, 4xrm_B, 2d5v_B, 5zfz_A
Binding Motifs: 4xrm_AB TGACAATTGTCA
4xrm_B TTGTCA
Binding Sites: 4xrm_L
4xrm_M
			
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.