Transcription Factor

Accessions: 5d5x_E (3D-footprint 20260701)
Names: Putative transcription factor, SKN7_CHATD
Organisms: Chaetomium thermophilum, strain DSM 1495 / CBS 144.50 / IMI 039719
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: G0SB31
Length: 98
Pfam Domains: 3-98 HSF-type DNA-binding
Sequence:
(in bold interface residues)
1 SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNK 60
61 YDFHKVRHNSPYGRDAWEFKHPEFRADRKDNLDNIRRK
Interface Residues: 47, 48, 52, 53, 55, 56, 57, 59, 60, 97
3D-footprint Homologues: 5hdn_C, 7jsa_J, 3hts_B, 5d5v_B, 5d5w_B, 7dci_A
Binding Motifs: 5d5x_BE CCcAGCm
5d5x_E TGGCTG
Binding Sites: 5d5x_A
5d5x_D
Publications: Neudegger T, Verghese J, Hayer-Hartl M, Hartl FU, Bracher A. Structure of human heat-shock transcription factor 1 in complex with DNA. Nat Struct Mol Biol 23:140-6 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.