Transcription Factor

Accessions: IRF3 (HT-SELEX2 May2017)
Names: ENSG00000126456, IRF3
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: IRF experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: IRF experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: IRF experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3, TF family: IRF experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4
Length: 128
Pfam Domains: 5-109 Interferon regulatory factor transcription factor
Sequence:
(in bold interface residues)
1 TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATG 60
61 AYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDT 120
121 SPDTNGGG
Interface Residues: 38, 40, 72, 76, 77, 79, 80, 81, 83, 84
3D-footprint Homologues: 2pi0_B, 1if1_B, 2o61_A, 8hcm_A, 2irf_L, 7oot_B, 8hcl_A
Binding Motifs: IRF3_2 kCrGTTTCsvsGAAACcGaAAcy
IRF3_4 agGAAAcsGAAACcGAAACw
IRF3_methyl_1 kCdGTTTCCwGGAAAcyrAaAc
IRF3_methyl_3 mGGAAAggGAAAsbGAAAsw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.