Transcription Factor

						

			
Accessions: 6ako_C (3D-footprint 20231221)

			
Names: Forkhead box protein C2, Forkhead-related protein FKHL14, FOXC2_HUMAN, Mesenchyme fork head protein 1, MFH-1 protein, Transcription factor FKH-14
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q99958
Length: 97
Pfam Domains:      3-97 Fork head domain
Sequence: 
(in bold interface residues)		   1 GPKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNEC   60
  61 FVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRR
Interface Residues: 43, 46, 48, 49, 50, 52, 53, 54, 56, 57, 66, 73
3D-footprint Homologues: 3l2c_A, 7vox_H, 2hdc_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 3qrf_G
Binding Motifs: 6ako_C TgtTTA
Binding Sites: 6ako_B
6ako_A
			
Publications: Chen X, Wei H, Li J, Liang X, Dai S, Jiang L, Guo M, Qu L, Chen Z, Chen L, Chen Y. Structural basis for DNA recognition by FOXC2. Nucleic Acids Res 47:3752-3764 (2019). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.