Transcription Factor
| Accessions: | 4uno_A (3D-footprint 20250804) |
| Names: | ETS TRANSLOCATION VARIANT 5, Ets-related protein ERM, ETV5_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P41161 |
| Length: | 95 |
| Pfam Domains: | 2-83 Ets-domain |
| Sequence: (in bold interface residues) | 1 SLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSL 60 61 RYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPD |
| Interface Residues: | 42, 54, 55, 57, 58, 59, 61, 62, 76 |
| 3D-footprint Homologues: | 6sjf_B, 8smj_F, 1dux_F, 7jsa_J, 3zp5_A, 4mhg_A, 8ee9_F, 4uno_A, 2stt_A, 8smh_F, 3jtg_A, 4lg0_B, 1yo5_C, 4iri_A, 1awc_A, 4l18_B, 1bc8_C |
| Binding Motifs: | 4uno_A CGGa |
| Binding Sites: | 4uno_B 4uno_C |
| Publications: | Cooper C.D, Newman J.A, Aitkenhead H, Allerston C.K, Gileadi O. Structures of the Ets Domains of Transcription Factors ETV1, ETV4, ETV5 and FEV: Determinants of DNA Binding and Redox Regulation by Disulfide bond formation. The Journal of biological chemistry : (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.