Transcription Factor

Accessions: 1cqt_B (3D-footprint 20250804)
Names: NF-A1, Oct-1, Octamer-binding protein 1, Octamer-binding transcription factor 1, OTF-1, PO2F1_HUMAN, POU DOMAIN, CLASS 2, TRANSCRIPTION FACTOR 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14859
Length: 129
Pfam Domains: 1-70 Pou domain - N-terminal to homeobox domain
71-126 Homeobox domain
Sequence:
(in bold interface residues)
1 DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYNDFSQTTISRFEALNLSFKNMCKLKP 60
61 LLEKWLNDAERKKRTSIETNIRVALEKSFLENQKTSEEITMIADQLNMEKEVIRVWFCNR 120
121 RQKEKRINP
Interface Residues: 23, 38, 39, 40, 41, 43, 44, 50, 54, 71, 72, 73, 74, 111, 112, 114, 115, 118, 119, 121, 122, 123, 126
3D-footprint Homologues: 3d1n_M, 7u0g_M, 8bx1_A, 2xsd_C, 1o4x_A, 1e3o_C, 7xrc_C, 8g87_X, 1au7_A, 1ig7_A, 8ejp_B, 1puf_A, 8pmf_A, 1fjl_B, 6a8r_A, 2r5y_A, 6m3d_C, 2lkx_A, 1zq3_P, 1nk2_P, 6es3_K, 7q3o_C, 2hdd_A, 8eml_B, 4xrs_G, 3a01_E, 5zjt_E, 8ik5_C, 1b72_A, 5hod_A, 5jlw_D, 2ld5_A, 8osb_E, 1le8_A, 4qtr_D, 1du0_A, 3lnq_A, 1jgg_B, 3rkq_B, 7psx_B, 5flv_I, 3cmy_A, 9b8u_A, 4cyc_A
Binding Motifs: 1cqt_BJ TATTTGCATA
Binding Sites: 1cqt_O
1cqt_P
Publications: Chasman D, Cepek K, Sharp P.A, Pabo C.O. Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface. Genes & development 13:2650-7 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.