Transcription Factor

Accessions: 2uzk_A (3D-footprint 20241219)
Names: AF6q21 protein, FORKHEAD BOX PROTEIN O3A, Forkhead in rhabdomyosarcoma-like 1, FOXO3_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O43524
Length: 97
Pfam Domains: 4-84 Fork head domain
Sequence:
(in bold interface residues)
1 MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSL 60
61 HSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS
Interface Residues: 24, 48, 49, 51, 52, 53, 55, 56, 57, 59, 60, 69, 74
3D-footprint Homologues: 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7yz7_A, 3g73_A, 7tdx_A, 2a07_J, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 7yzg_A, 7tdw_A, 8sro_B
Binding Motifs: 2uzk_A tGtTTA
Binding Sites: 2uzk_B
2uzk_E
Publications: Tsai K. L., Sun Y. J., Huang C. Y., Yang J. Y., Hung M. C., Hsiao C. D. Crystal structure of the human FOXO3a-DBD/DNA complex suggests the effects of post-translational modification.. Nucleic Acids Res. 35:6984-6994 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.