Transcription Factor
Accessions: | 2uzk_A (3D-footprint 20231221) |
Names: | AF6q21 protein, FORKHEAD BOX PROTEIN O3A, Forkhead in rhabdomyosarcoma-like 1, FOXO3_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | O43524 |
Length: | 97 |
Pfam Domains: | 4-84 Fork head domain |
Sequence: (in bold interface residues) | 1 MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSL 60 61 HSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS |
Interface Residues: | 46, 49, 51, 52, 53, 55, 56, 57, 59, 60, 69, 74, 93 |
3D-footprint Homologues: | 3l2c_A, 7vox_H, 2hdc_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 3qrf_G |
Binding Motifs: | 2uzk_A tGtTTA |
Binding Sites: | 2uzk_B 2uzk_E |
Publications: | Tsai K. L., Sun Y. J., Huang C. Y., Yang J. Y., Hung M. C., Hsiao C. D. Crystal structure of the human FOXO3a-DBD/DNA complex suggests the effects of post-translational modification.. Nucleic Acids Res. 35:6984-6994 (2007). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.