Transcription Factor

Accessions: 2hdd_A (3D-footprint 20231221)
Names: ENGRAILED HOMEODOMAIN Q50K, HMEN_DROME
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P02836
Length: 55
Pfam Domains: 1-54 Homeobox domain
Sequence:
(in bold interface residues)
1 RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKRAKIKKS
Interface Residues: 1, 39, 40, 42, 43, 46, 47, 50, 51, 54
3D-footprint Homologues: 1b72_A, 5hod_A, 3lnq_A, 2ld5_A, 1ig7_A, 6a8r_A, 3cmy_A, 2h1k_B, 6m3d_C, 5jlw_D, 3rkq_B, 2lkx_A, 1puf_A, 1jgg_B, 6es3_K, 4xrs_G, 3d1n_M, 2hdd_A, 7psx_B, 5zfz_A, 4cyc_A, 2r5y_A, 1au7_A, 5flv_I, 2hos_A, 1nk2_P, 7q3o_C, 1fjl_B, 5zjt_E, 4j19_B, 3a01_E, 1le8_A, 1e3o_C, 1zq3_P, 6fqq_E, 1o4x_A, 8g87_X, 4qtr_D, 1le8_B, 1du0_A, 1mnm_C, 1puf_B, 1k61_B, 6fqp_B, 3l1p_A
Binding Motifs: 2hdd_A tGGATTAC
2hdd_AB TCcnnGGaTTAC
Binding Sites: 2hdd_C
2hdd_D
Publications: Tucker-Kellogg L, Rould M.A, Chambers K.A, Ades S.E, Sauer R.T, Pabo C.O. Engrailed (Gln50-->Lys) homeodomain-DNA complex at 1.9 A resolution: structural basis for enhanced affinity and altered specificity. Structure (London, England : 1993) 5:1047-54 (1997). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.