Transcription Factor
| Accessions: | 2hdd_A (3D-footprint 20250804) |
| Names: | ENGRAILED HOMEODOMAIN Q50K, HMEN_DROME |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P02836 |
| Length: | 55 |
| Pfam Domains: | 1-54 Homeobox domain |
| Sequence: (in bold interface residues) | 1 RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKRAKIKKS |
| Interface Residues: | 1, 39, 40, 42, 43, 46, 47, 49, 50, 51, 54 |
| 3D-footprint Homologues: | 1puf_A, 1jgg_B, 5hod_A, 3lnq_A, 2hos_A, 9b8u_A, 6a8r_A, 3a01_E, 8ik5_C, 6m3d_C, 1au7_A, 5jlw_D, 3rkq_B, 2ld5_A, 1nk2_P, 8ejp_B, 1fjl_B, 6es3_K, 4xrs_G, 3cmy_A, 8osb_E, 7psx_B, 1b72_A, 5zfz_A, 4cyc_A, 2lkx_A, 8eml_B, 1ig7_A, 5flv_I, 3d1n_M, 2hdd_A, 8pmf_A, 7q3o_C, 5zjt_E, 4j19_B, 2r5y_A, 1e3o_C, 1le8_A, 8g87_X, 6fqq_E, 1mnm_C, 8bx1_A, 4qtr_D, 1puf_B, 1k61_B, 1zq3_P, 1o4x_A, 6fqp_B, 1le8_B, 1du0_A |
| Binding Motifs: | 2hdd_A tGGATTAC 2hdd_AB TCcnnGGaTTAC |
| Binding Sites: | 2hdd_C 2hdd_D |
| Publications: | Tucker-Kellogg L, Rould M.A, Chambers K.A, Ades S.E, Sauer R.T, Pabo C.O. Engrailed (Gln50-->Lys) homeodomain-DNA complex at 1.9 A resolution: structural basis for enhanced affinity and altered specificity. Structure (London, England : 1993) 5:1047-54 (1997). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.