Transcription Factor
| Accessions: | ZSCAN4 (HT-SELEX2 May2017) |
| Names: | ENSG00000180532, ZSCAN4 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 139 |
| Pfam Domains: | 6-29 Zinc-finger double domain 18-42 C2H2-type zinc finger 18-40 Zinc finger, C2H2 type 18-40 C2H2-type zinc finger 32-55 Zinc-finger double domain 46-64 C2H2-type zinc finger 46-68 Zinc finger, C2H2 type 46-68 C2H2-type zinc finger 60-85 Zinc-finger double domain 73-92 C2H2-type zinc finger 74-95 Zinc-finger of C2H2 type 74-96 Zinc finger, C2H2 type 74-96 C2H2-type zinc finger 88-111 Zinc-finger double domain 101-124 C2H2-type zinc finger 102-124 C2H2-type zinc finger 102-124 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 NSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFFQISD 60 61 LRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRH 120 121 MRTHEKITLPSVPSTPEAS |
| Interface Residues: | 2, 3, 18, 28, 29, 30, 31, 32, 34, 35, 37, 38, 41, 56, 57, 58, 59, 60, 62, 63, 66, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 99, 112, 113, 114, 115, 116, 117, 118, 119, 120 |
| 3D-footprint Homologues: | 5yel_A, 2kmk_A, 1tf3_A, 5v3j_F, 7w1m_H, 5ei9_F, 8ssq_A, 1tf6_A, 8ssu_A, 2gli_A, 5kkq_D, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 5kl3_A, 6ml4_A, 1f2i_J, 6blw_A, 5k5l_F, 4x9j_A, 1g2f_F, 8gn3_A, 8h9h_G, 7y3m_I, 2lt7_A, 6a57_A, 3uk3_C, 5yj3_D, 1llm_D, 7txc_E, 5k5i_A, 2drp_D, 6u9q_A, 2wbs_A, 4m9v_C, 1yuj_A |
| Binding Motifs: | ZSCAN4_2 syGCACACvCTGamAah ZSCAN4_methyl_1 syGCACACmCTGamAah |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.