Transcription Factor

Accessions: ZSCAN4 (HT-SELEX2 May2017)
Names: ENSG00000180532, ZSCAN4
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2
Length: 139
Pfam Domains: 6-29 Zinc-finger double domain
18-42 C2H2-type zinc finger
18-40 Zinc finger, C2H2 type
18-40 C2H2-type zinc finger
32-55 Zinc-finger double domain
46-64 C2H2-type zinc finger
46-68 Zinc finger, C2H2 type
46-68 C2H2-type zinc finger
60-85 Zinc-finger double domain
73-92 C2H2-type zinc finger
74-95 Zinc-finger of C2H2 type
74-96 Zinc finger, C2H2 type
74-96 C2H2-type zinc finger
88-111 Zinc-finger double domain
101-124 C2H2-type zinc finger
102-124 C2H2-type zinc finger
102-124 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 NSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFFQISD 60
61 LRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRH 120
121 MRTHEKITLPSVPSTPEAS
Interface Residues: 2, 3, 18, 28, 29, 30, 31, 32, 34, 35, 37, 38, 41, 56, 57, 58, 59, 60, 62, 63, 66, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 99, 112, 113, 114, 115, 116, 117, 118, 119, 120
3D-footprint Homologues: 5yel_A, 2kmk_A, 1tf3_A, 5v3j_F, 7w1m_H, 5ei9_F, 8ssq_A, 1tf6_A, 8ssu_A, 2gli_A, 5kkq_D, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 5kl3_A, 6ml4_A, 1f2i_J, 6blw_A, 5k5l_F, 4x9j_A, 1g2f_F, 8gn3_A, 8h9h_G, 7y3m_I, 2lt7_A, 6a57_A, 3uk3_C, 5yj3_D, 1llm_D, 7txc_E, 5k5i_A, 2drp_D, 6u9q_A, 2wbs_A, 4m9v_C, 1yuj_A
Binding Motifs: ZSCAN4_2 syGCACACvCTGamAah
ZSCAN4_methyl_1 syGCACACmCTGamAah
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.