Transcription Factor

Accessions: 3a01_A (3D-footprint 20241219)
Names: Homeodomain-containing protein, Q9VD99_DROME
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9VD99
Length: 78
Pfam Domains: 17-73 Homeobox domain
Sequence:
(in bold interface residues)
1 ARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQV 60
61 KTWFQNRRTKWRRQTAEE
Interface Residues: 17, 18, 19, 20, 58, 59, 61, 62, 65, 66, 68, 69, 70, 73
3D-footprint Homologues: 8pmf_A, 6m3d_C, 1zq3_P, 2lkx_A, 7q3o_C, 6es3_K, 2ld5_A, 2hos_A, 9b8u_A, 8ik5_C, 8ejp_B, 8osb_E, 7psx_B, 2hdd_A, 8eml_B, 4cyc_A, 7xrc_C, 8g87_X
Binding Motifs: 3a01_AB TTAATTAATTG
Publications: Miyazono K, Zhi Y, Takamura Y, Nagata K, Saigo K, Kojima T, Tanokura M. Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless. The EMBO journal 29:1613-23 (2010). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.