Transcription Factor

Accessions: 1lfu_P (3D-footprint 20231221)
Names: homeobox protein PBX1, PBX1_MOUSE, Pre-B-cell leukemia transcription factor 1
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P41778
Length: 82
Pfam Domains: 3-62 Homeobox domain
11-56 Homeodomain leucine-zipper encoding, Homez
21-59 Homeobox KN domain
Sequence:
(in bold interface residues)
1 MARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRY 60
61 KKNIGKFQEEANIYAAKTAVTA
Interface Residues: 3, 4, 5, 6, 47, 48, 50, 51, 54, 55, 58, 59, 62
3D-footprint Homologues: 5zfz_A, 6fqp_B, 1puf_A, 3cmy_A, 6a8r_A, 3d1n_M, 2lkx_A, 1zq3_P, 2ld5_A, 4j19_B, 5zjt_E, 5hod_A, 1puf_B, 1b72_A, 2r5y_A, 5jlw_D, 7q3o_C, 1le8_A, 1ig7_A, 4xrs_G, 3l1p_A, 1mnm_C, 7psx_B, 1du0_A, 3a01_E, 2d5v_B, 1k61_B, 5flv_I, 3lnq_A, 1fjl_B, 4qtr_D, 2h1k_B, 6fqq_E, 3rkq_B, 8g87_X, 4xrm_B, 2hdd_A, 1le8_B, 6m3d_C, 4cyc_A, 1jgg_B, 6es3_K, 2hos_A
Binding Motifs: 1lfu_P aaTnAT
Binding Sites: 1lfu_A
1lfu_B
Publications: Sprules T, Green N, Featherstone M, Gehring K. Lock and key binding of the HOX YPWM peptide to the PBX homeodomain. The Journal of biological chemistry 278:1053-8 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.