Transcription Factor

Accessions: 1b72_A (3D-footprint 20250804)
Names: Homeobox protein Hox-2I, HOMEOBOX PROTEIN HOX-B1, HXB1_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14653
Length: 68
Pfam Domains: 11-64 Homeobox domain
Sequence:
(in bold interface residues)
1 ARTFDWMKVLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRM 60
61 KQKKRERE
Interface Residues: 7, 8, 11, 49, 50, 52, 53, 56, 57, 59, 60, 61, 64
3D-footprint Homologues: 7q3o_C, 8eml_B, 1fjl_B, 6es3_K, 4xrs_G, 3cmy_A, 2hdd_A, 8pmf_A, 1b72_A, 5zfz_A, 4cyc_A, 2r5y_A, 1puf_A, 1ig7_A, 6m3d_C, 5flv_I, 3d1n_M, 2hos_A, 9b8u_A, 5zjt_E, 1puf_B, 8ik5_C, 1jgg_B, 7psx_B, 5hod_A, 3lnq_A, 2ld5_A, 1nk2_P, 8ejp_B, 6a8r_A, 3a01_E, 8osb_E, 1au7_A, 5jlw_D, 3rkq_B, 2lkx_A, 1le8_A, 7xrc_C, 4j19_B, 2xsd_C, 1e3o_C, 1o4x_A, 8g87_X, 1mnm_C, 8bx1_A, 1du0_A, 4qtr_D, 1zq3_P, 1k61_B
Binding Motifs: 1b72_A TTCa
1b72_AB ATGATTGAA
Binding Sites: 1b72_D
1b72_E
Publications: Piper D.E, Batchelor A.H, Chang C.P, Cleary M.L, Wolberger C. Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation. Cell 96:587-97 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.