Transcription Factor
| Accessions: | DREB1A (Athamap 20091028), T000667_1.02 (CISBP 1.02), Q9M0L0 (JASPAR 2024), T18159 (AthalianaCistrome v4_May2016) |
| Names: | C-repeat-binding factor 3, C-repeat/dehydration-responsive element-binding factor 3, CBF3, Cold resistance-related AP2 transcription factor, CRT/DRE-binding factor 3, Dehydration-responsive element-binding protein 1A, DREB1A, Protein DREB1A, ATCBF3, T000667_1.02;, DRE1A_ARATH, AT4G25480, T18159; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | Athamap 20091028 1, CISBP 1.02 2, JASPAR 2024 3, AthalianaCistrome v4_May2016 4 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 4 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Uniprot: | Q9M0L0 |
| Notes: | experiment type:PBM, family:AP2, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP |
| Length: | 216 |
| Pfam Domains: | 50-99 AP2 domain |
| Sequence: (in bold interface residues) | 1 MNSFSAFSEMFGSDYESSVSSGGDYIPTLASSCPKKPAGRKKFRETRHPIYRGVRRRNSG 60 61 KWVCEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFADSAWRLRIPESTC 120 121 AKDIQKAAAEAALAFQDEMCDATTDHGFDMEETLVEAIYTAEQSENAFYMHDEAMFEMPS 180 181 LLANMAEGMLLPLPSVQWNHNHEVDGDDDDVSLWSY |
| Interface Residues: | 55, 56, 57, 58, 59, 63, 65, 67, 74, 76 |
| 3D-footprint Homologues: | 5wx9_A, 1gcc_A, 7wq5_A |
| Binding Motifs: | DREB1A TACTrCCGACAtGA M0031_1.02 tatGTCGGyr MA0971.1 atGTCGGyrr M0041 kATGTCGGyrr M0053 ywyyrCCGACawmr MA0971.2 atGTCGGy |
| Binding Sites: | DREB1A_1 MA0971.2.16 DREB1A_10 DREB1A_2 DREB1A_3 DREB1A_4 DREB1A_5 DREB1A_6 DREB1A_7 DREB1A_8 DREB1A_9 MA0971.1.1 MA0971.1.10 / MA0971.1.12 MA0971.1.11 MA0971.1.13 MA0971.1.14 / MA0971.1.15 MA0971.1.16 MA0971.1.17 MA0971.1.18 MA0971.1.19 MA0971.1.2 MA0971.1.20 MA0971.1.3 MA0971.1.4 MA0971.1.5 MA0971.1.6 / MA0971.1.7 MA0971.1.8 MA0971.1.9 MA0971.2.1 MA0971.2.10 / MA0971.2.12 MA0971.2.11 MA0971.2.13 MA0971.2.14 / MA0971.2.15 MA0971.2.17 MA0971.2.18 MA0971.2.19 MA0971.2.2 MA0971.2.20 MA0971.2.3 MA0971.2.4 MA0971.2.5 MA0971.2.6 / MA0971.2.7 MA0971.2.8 MA0971.2.9 |
| Publications: | Maruyama K, Sakuma Y, Kasuga M, Ito Y, Seki M, Goda H, Shimada Y, Yoshida S, Shinozaki K, Yamaguchi-Shinozaki K. 2004. Identification of cold-inducible downstream genes of the Arabidopsis DREB1A/CBF3 transcriptional factor using two microarray systems. : Plant J. 38:982-93. [Pubmed] Narusaka Y, Nakashima K, Shinwari ZK, Sakuma Y, Furihata T, Abe H, Narusaka M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. Interaction between two cis-acting elements, ABRE and DRE, in ABA-dependent expression of Arabidopsis rd29A gene in response to dehydration and high-salinity stresses. Plant J. 34:137-48. [Pubmed] Gilmour SJ, Zarka DG, Stockinger EJ, Salazar MP, Houghton JM, Thomashow MF. 1998. Low temperature regulation of the Arabidopsis CBF family of AP2 transcriptional activators as an early step in cold-induced COR gene expression. Plant J. 16:433-42. [Pubmed] Sakuma Y, Maruyama K, Osakabe Y, Qin F, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of an Arabidopsis transcription factor, DREB2A, involved in drought-responsive gene expression. Plant Cell 18: 1292-309. [Pubmed] Medina J, Bargues M, Terol J, Pérez-Alonso M, Salinas J. The Arabidopsis CBF gene family is composed of three genes encoding AP2 domain-containing proteins whose expression Is regulated by low temperature but not by abscisic acid or dehydration. Plant Physiol 119:463-70 (1999). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.