Transcription Factor
| Accessions: | ECK120005105 (RegulonDB 7.5) |
| Names: | NagC, NagC DNA-binding transcriptional dual regulator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The NagC, N-acetylglucosamine, transcriptional dual regulator participates in regulating the phosphotransferase system (PTS) Pennetier C,2008 Its function is to coordinate the biosynthesis of the amino sugars, D-glucosamine (GlcN) and N-acetylglucosamine (GlcNAc) with their catabolism Plumbridge JA.,1991; Plumbridge J.,2001; Plumbridge J,2004.The specific inducer for NagC is GlcNAc-6-P, the product of GlcNAc transport by the PTS Plumbridge JA.,1991; Plumbridge J.,2001 NagC is displaced from its DNA targets by interacting with GlcNAc-6-P Plumbridge JA.,1991Based on the structure of DgsA DNA-binding transcriptional repressor, models for the three-dimensional structure of NagC and for the binding of GlcNAc-6-P were developed Pennetier C,2008The Nag regulon consists of two divergent operons, nagE and nagBACD; nagC encodes the repressor of this regulon; Its localization within the inducible nagBACD operon is unusual, since most transcriptional dual regulators are located near the loci they control Plumbridge JA.,1991NagC is present at low levels within the bacterial cell Plumbridge JA.,1991The consensus sequence for the NagC-binding site has been determined via combination of native site comparisons, operator mutagenesis, and selection of DNA-binding fragments, Plumbridge J.,2001 The dual function of NagC requires it to bind simultaneously to two operators in order to form a DNA loop Plumbridge J.,2001 The strictly conserved TT/AA motif, located in both ends of the center of symmetry, is probably the major recognition point for NagC Plumbridge J.,2001NagC is a member of the ROK (repressor, ORFs, kinases) (NagC/XylR) family of proteins, which contains at least two distinct classes of proteins, xylose repressor (XylR) and a series of glucose/fructose kinases Titgemeyer F,1994; Hansen T,2002; NagC is similar to Mlc transcriptional dual regulator Cho S,2005 However, they have different specificities for select binding sites Plumbridge J.,2001.NagC has a helix-turn-helix motif in its N-terminal part Pennetier C,2008.; translation attenuation and efficiency; repressor; operon; activator; Transcription related; amino sugar conversions; transcription, DNA-dependent; regulation of transcription, DNA-dependent; carbohydrate metabolic process; intracellular; sequence-specific DNA binding transcription factor activity; DNA binding; cytoplasm |
| Length: | 407 |
| Pfam Domains: | 25-63 MarR family 90-274 ROK family |
| Sequence: (in bold interface residues) | 1 MTPGGQAQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERG 60 61 LIKEVDQQASTGGRRAISIVTETRNFHAIGVRLGRHDATITLFDLSSKVLAEEHYPLPER 120 121 TQQTLEHALLNAIAQFIDSYQRKLRELIAISVILPGLVDPDSGKIHYMPHIQVENWGLVE 180 181 ALEERFKVTCFVGHDIRSLALAEHYFGASQDCEDSILVRVHRGTGAGIISNGRIFIGRNG 240 241 NVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLNLLKQGYQSRVPLDDCTIKTI 300 301 CKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITEADKVLLPAIESCIN 360 361 TQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGILLQHLLEN* |
| Interface Residues: | 12, 36, 45, 46, 47, 48, 50, 51, 67, 74 |
| 3D-footprint Homologues: | 5f7q_C, 8pw0_A, 9c4c_G, 5yi2_J |
| Binding Motifs: | NagC wswTAwTTykhrtmryrAAwTA |
| Binding Sites: | ECK120011910 ECK120011913 ECK120012042 ECK120012044 ECK120012577 ECK120012579 ECK120013206 ECK120013590 ECK120013593 ECK120016170 ECK120048747 ECK125134894 ECK125134902 ECK125134904 ECK125134906 ECK125134912 |
| Publications: | Pennetier C., Dominguez-Ramirez L., Plumbridge J. Different regions of Mlc and NagC, homologous transcriptional repressors controlling expression of the glucose and N-acetylglucosamine phosphotransferase systems in Escherichia coli, are required for inducer signal recognition. Mol Microbiol. 67(2):364-77 (2008). [Pubmed] Plumbridge JA. Repression and induction of the nag regulon of Escherichia coli K-12: the roles of nagC and nagA in maintenance of the uninduced state. Mol Microbiol. 5(8):2053-62 (1991). [Pubmed] Plumbridge J. Regulation of PTS gene expression by the homologous transcriptional regulators, Mlc and NagC, in Escherichia coli (or how two similar repressors can behave differently). J Mol Microbiol Biotechnol. 3(3):371-80 (2001). [Pubmed] Plumbridge J. DNA binding sites for the Mlc and NagC proteins: regulation of nagE, encoding the N-acetylglucosamine-specific transporter in Escherichia coli. Nucleic Acids Res. 29(2):506-14 (2001). [Pubmed] Plumbridge J., Pellegrini O. Expression of the chitobiose operon of Escherichia coli is regulated by three transcription factors: NagC, ChbR and CAP. Mol Microbiol. 52(2):437-49 (2004). [Pubmed] Titgemeyer F., Reizer J., Reizer A., Saier MH. Evolutionary relationships between sugar kinases and transcriptional repressors in bacteria. Microbiology. 140 ( Pt 9):2349-54 (1994). [Pubmed] Hansen T., Reichstein B., Schmid R., Schonheit P. The first archaeal ATP-dependent glucokinase, from the hyperthermophilic crenarchaeon Aeropyrum pernix, represents a monomeric, extremely thermophilic ROK glucokinase with broad hexose specificity. J Bacteriol. 184(21):5955-65 (2002). [Pubmed] Cho S., Shin D., Ji GE., Heu S., Ryu S. High-level recombinant protein production by overexpression of Mlc in Escherichia coli. J Biotechnol. 119(2):197-203 (2005). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.