Transcription Factor
Accessions: | ECK120005288 (RegulonDB 7.5) |
Names: | RcsB |
Organisms: | ECK12 |
Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
Notes: | RcsB protein for Regulator capsule synthesis B, is a response regulator that belongs to the multicomponent RcsF/RcsC/RcsD/RcsA-RcsB phosphorelay system Chen MH,2001; Castanie-Cornet MP,2007; Majdalani N,2005; Castanie-Cornet MP,2006; Gottesman S,1991and is involved in the regulation of the synthesis of colanic acid capsule, cell division, periplasmic proteins, motility, and a small RNA Huang YH,2006; Stout V.,; Jayaratne P,1993; Brill JA,1988; Wehland M,2000; Sledjeski DD,1996; Carballes F,1999; Gottesman S,1985; Stout V,1991; Sledjeski D,1995; Stout V.,1996; Francez-Charlot A,2003; Vianney A,2005; Fredericks CE,2006; Corbett D,2008; The response regulator RcsB is the principal regulator of this system and it may form complexes with the RcsA auxiliary protein (forming a heterodimer) Gottesman S,1991; Ogasawara H,2007; Ferrieres L,2007 while RcsB activates the others genes independently (in the form of a homodimer) Majdalani N,2005; Davalos-Garcia M,2001; Francez-Charlot A,2005; Boulanger A,2005; Majdalani N,2002; Gervais FG,1992RcsC is a sensor histidine kinase and is known to be a transmembrane protein composed of three domains: the external sensory domain (amino terminal), a cytoplasmic transmitter domain (carboxyl terminal), and a transmembrane hydrophobic central domain (unknown function); RcsC is a membrane-bound protein that is able to sense extracellular changes in temperature, overexpression of membrane protein, and osmolarity Mouslim C,2003; Sledjeski DD,1996 RcsC is a hybrid kinase, contains both an H1 and D1 domain, and is able to transfer phosphoryl groups to the conserved Hpt domain of RcsD Majdalani N,2005; Huang YH,2006; Majdalani N,2005 RcsC and RcsD are inner membrane proteins that are involved in the phosphorylation of RcsB in response to environmental signals Majdalani N,2005; Gupte G,1997; Schmoe K,2011 Once phosphorylated, the RcsB protein is a positive regulator and it increases the affinity for the specific DNA-binding sites and controls the transcriptional expression of operons Wehland M,2000; Majdalani N,2005 It is believed that RcsF protein may also be capable of phosphorylating RcsB.The RcsB/RcsA complex has major affinity for binding sites of which RcsB is only one; The homodimers of RcsB activate transcription, interacting with the RNA polymerase, by overlapping the -35 box of the core promoter; the central position of the binding site is located near bp -41.5 Majdalani N,2005; Majdalani N,2002 The formation of heterodimers between RcsB and the RcsA auxiliary protein stabilizes interactions with the distant binding sites Wehland M,2000; Ferrieres L,2007The amount of RcsA protein is limited both by its rapid degradation by two proteases, Lon and ClpYQ, and by its low level of synthesis Majdalani N,2005; Torres-Cabassa AS,1987; Dierksen KP,1996; Gottesman S,1991; Kuo MS,2004; Lee YY,2003 RcsB, which belongs to the two-component family, shows a helix-turn-helix motif for interaction with DNA in the C-terminal domain, while the the N-terminal domain is typical of the response regulator Majdalani N,2005Regulator protein RcsB is a member of the two-component regulatory system RcsC/RcsB Stout V.,; Brill JA,1988 It is involved in the activation of colanic acid capsule synthesis (cps) and cell division (ftsZ) genes Wehland M,2000; Carballes F,1999Based on its homology to other regulator proteins in E. coli, it is believed that the RcsB protein is activated through phosphorylation, probably by the sensor protein RcsC Gupte G,1997 However, direct phosphorylation of RcsB by RcsC has not been shown; The RcsF protein may also be capable of phosphorylating RcsB; Once activated, the RcsB protein is a positive regulator of capsule synthesis and cell division Wehland M,2000; Carballes F,1999 Regulator protein RcsB complexes with the RcsA protein (forming a heterodimer) for capsule synthesis activation Wehland M,2000; Stout V., RcsB activates the fts genes independently (in the form of a homodimer) Gervais FG,1992 RcsB is a member of the LuxR/UhpA protein family.Overproduction causes a drug resistance phenotype and affects transcription of genes involved in drug efflux Hirakawa H,2003.; colanic acid (M antigen); regulation of transcription, DNA-dependent; intracellular; sequence-specific DNA binding transcription factor activity; DNA binding; two-component signal transduction system (phosphorelay); two-component response regulator activity; colanic acid biosynthetic process; transcription, DNA-dependent; transcription activator activity; transcription repressor activity; cytoplasm; two component regulatory systems (external signal); repressor; activator; capsule (M and K antigens); surface antigens (ECA, O antigen of LPS); operon; intracellular signal transduction; sequence-specific DNA binding; Transcription related |
Length: | 217 |
Pfam Domains: | 6-120 Response regulator receiver domain 149-204 Bacterial regulatory proteins, luxR family |
Sequence: (in bold interface residues) | 1 MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMP 60 61 GDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKAL 120 121 AALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIK 180 181 TISSQKKSAMMKLGVENDIALLNYLSSVTLSPADKD* |
Interface Residues: | 91, 92, 93, 95, 96, 117, 128, 178, 179, 180, 181, 183, 184, 185, 187 |
3D-footprint Homologues: | 3zpl_B, 7btq_A, 7ve5_B, 5w43_B, 4wuh_B, 1je8_F, 1zlk_A, 6ide_A |
Binding Motifs: | RcsB AwYmrGAyKWwTYT |
Binding Sites: | ECK120011326 ECK120011819 ECK120012275 ECK120013232 ECK120013577 ECK120015223 ECK120015225 ECK120015810 ECK120015814 ECK120029979 ECK120048839 ECK125109046 ECK125109049 ECK125109444 ECK125141920 |
Publications: | Hirakawa H., Nishino K., Hirata T., Yamaguchi A. Comprehensive studies of drug resistance mediated by overexpression of response regulators of two-component signal transduction systems in Escherichia coli. J Bacteriol. 185(6):1851-6 (2003). [Pubmed] Chen MH., Takeda S., Yamada H., Ishii Y., Yamashino T., Mizuno T. Characterization of the RcsC-->YojN-->RcsB phosphorelay signaling pathway involved in capsular synthesis in Escherichia coli. Biosci Biotechnol Biochem. 65(10):2364-7 (2001). [Pubmed] Castanie-Cornet MP., Treffandier H., Francez-Charlot A., Gutierrez C., Cam K. The glutamate-dependent acid resistance system in Escherichia coli: essential and dual role of the His-Asp phosphorelay RcsCDB/AF. Microbiology. 153(Pt 1):238-46 (2007). [Pubmed] Majdalani N., Gottesman S. The Rcs phosphorelay: a complex signal transduction system. Annu Rev Microbiol. 59:379-405 (2005). [Pubmed] Majdalani N., Heck M., Stout V., Gottesman S. Role of RcsF in signaling to the Rcs phosphorelay pathway in Escherichia coli. J Bacteriol. 187(19):6770-8 (2005). [Pubmed] Castanie-Cornet MP., Cam K., Jacq A. RcsF is an outer membrane lipoprotein involved in the RcsCDB phosphorelay signaling pathway in Escherichia coli. J Bacteriol. 188(12):4264-70 (2006). [Pubmed] Gottesman S., Stout V. Regulation of capsular polysaccharide synthesis in Escherichia coli K12. Mol Microbiol. 5(7):1599-606 (1991). [Pubmed] Huang YH., Ferrieres L., Clarke DJ. The role of the Rcs phosphorelay in Enterobacteriaceae. Res Microbiol. 157(3):206-12 (2006). [Pubmed] Stout V. Regulation of capsule synthesis includes interactions of the RcsC/RcsB regulatory pair. Res Microbiol. 145(5-6):389-92 (). [Pubmed] Jayaratne P., Keenleyside WJ., MacLachlan PR., Dodgson C., Whitfield C. Characterization of rcsB and rcsC from Escherichia coli O9:K30:H12 and examination of the role of the rcs regulatory system in expression of group I capsular polysaccharides. J Bacteriol. 175(17):5384-94 (1993). [Pubmed] Brill JA., Quinlan-Walshe C., Gottesman S. Fine-structure mapping and identification of two regulators of capsule synthesis in Escherichia coli K-12. J Bacteriol. 170(6):2599-611 (1988). [Pubmed] Wehland M., Bernhard F. The RcsAB box. Characterization of a new operator essential for the regulation of exopolysaccharide biosynthesis in enteric bacteria. J Biol Chem. 275(10):7013-20 (2000). [Pubmed] Sledjeski DD., Gottesman S. Osmotic shock induction of capsule synthesis in Escherichia coli K-12. J Bacteriol. 178(4):1204-6 (1996). [Pubmed] Carballes F., Bertrand C., Bouche JP., Cam K. Regulation of Escherichia coli cell division genes ftsA and ftsZ by the two-component system rcsC-rcsB. Mol Microbiol. 34(3):442-50 (1999). [Pubmed] Gottesman S., Trisler P., Torres-Cabassa A. Regulation of capsular polysaccharide synthesis in Escherichia coli K-12: characterization of three regulatory genes. J Bacteriol. 162(3):1111-9 (1985). [Pubmed] Stout V., Torres-Cabassa A., Maurizi MR., Gutnick D., Gottesman S. RcsA, an unstable positive regulator of capsular polysaccharide synthesis. J Bacteriol. 173(5):1738-47 (1991). [Pubmed] Sledjeski D., Gottesman S. A small RNA acts as an antisilencer of the H-NS-silenced rcsA gene of Escherichia coli. Proc Natl Acad Sci U S A. 92(6):2003-7 (1995). [Pubmed] Stout V. Identification of the promoter region for the colanic acid polysaccharide biosynthetic genes in Escherichia coli K-12. J Bacteriol. 178(14):4273-80 (1996). [Pubmed] Francez-Charlot A., Laugel B., Van Gemert A., Dubarry N., Wiorowski F., Castani?-Cornet MP., Gutierrez C., Cam K. RcsCDB His-Asp phosphorelay system negatively regulates the flhDC operon in Escherichia coli. Mol Microbiol. 49(3):823-32 (2003). [Pubmed] Vianney A., Jubelin G., Renault S., Dorel C., Lejeune P., Lazzaroni JC. Escherichia coli tol and rcs genes participate in the complex network affecting curli synthesis. Microbiology. 151(Pt 7):2487-97 (2005). [Pubmed] Fredericks CE., Shibata S., Aizawa S., Reimann SA., Wolfe AJ. Acetyl phosphate-sensitive regulation of flagellar biogenesis and capsular biosynthesis depends on the Rcs phosphorelay. Mol Microbiol. 61(3):734-47 (2006). [Pubmed] Corbett D., Roberts IS. Capsular polysaccharides in Escherichia coli. Adv Appl Microbiol. 65:1-26 (2008). [Pubmed] Ogasawara H., Hasegawa A., Kanda E., Miki T., Yamamoto K., Ishihama A. Genomic SELEX search for target promoters under the control of the PhoQP-RstBA signal relay cascade. J Bacteriol. 189(13):4791-9 (2007). [Pubmed] Ferrieres L., Aslam SN., Cooper RM., Clarke DJ. The yjbEFGH locus in Escherichia coli K-12 is an operon encoding proteins involved in exopolysaccharide production. Microbiology. 153(Pt 4):1070-80 (2007). [Pubmed] Davalos-Garcia M., Conter A., Toesca I., Gutierrez C., Cam K. Regulation of osmC gene expression by the two-component system rcsB-rcsC in Escherichia coli. J Bacteriol. 183(20):5870-6 (2001). [Pubmed] Francez-Charlot A., Castanie-Cornet MP., Gutierrez C., Cam K. Osmotic Regulation of the Escherichia coli bdm (Biofilm-Dependent Modulation) Gene by the RcsCDB His-Asp Phosphorelay. J Bacteriol. 187(11):3873-7 (2005). [Pubmed] Boulanger A., Francez-Charlot A., Conter A., Castanie-Cornet MP., Cam K., Gutierrez C. Multistress regulation in Escherichia coli: expression of osmB involves two independent promoters responding either to sigmaS or to the RcsCDB His-Asp phosphorelay. J Bacteriol. 187(9):3282-6 (2005). [Pubmed] Majdalani N., Hernandez D., Gottesman S. Regulation and mode of action of the second small RNA activator of RpoS translation, RprA. Mol Microbiol. 46(3):813-26 (2002). [Pubmed] Gervais FG., Phoenix P., Drapeau GR. The rcsB gene, a positive regulator of colanic acid biosynthesis in Escherichia coli, is also an activator of ftsZ expression. J Bacteriol. 174(12):3964-71 (1992). [Pubmed] Mouslim C., Latifi T., Groisman EA. Signal-dependent requirement for the co-activator protein RcsA in transcription of the RcsB-regulated ugd gene. J Biol Chem. 278(50):50588-95 (2003). [Pubmed] Gupte G., Woodward C., Stout V. Isolation and characterization of rcsB mutations that affect colanic acid capsule synthesis in Escherichia coli K-12. J Bacteriol. 179(13):4328-35 (1997). [Pubmed] Schmoe K., Rogov VV., Rogova NY., Lohr F., Guntert P., Bernhard F., Dotsch V. Structural insights into Rcs phosphotransfer: the newly identified RcsD-ABL domain enhances interaction with the response regulator RcsB. Structure. 19(4):577-87 (2011). [Pubmed] Torres-Cabassa AS., Gottesman S. Capsule synthesis in Escherichia coli K-12 is regulated by proteolysis. J Bacteriol. 169(3):981-9 (1987). [Pubmed] Dierksen KP., Trempy JE. Identification of a second RcsA protein, a positive regulator of colanic acid capsular polysaccharide genes, in Escherichia coli. J Bacteriol. 178(16):5053-6 (1996). [Pubmed] Kuo MS., Chen KP., Wu WF. Regulation of RcsA by the ClpYQ (HslUV) protease in Escherichia coli. Microbiology. 150(Pt 2):437-46 (2004). [Pubmed] Lee YY., Chang CF., Kuo CL., Chen MC., Yu CH., Lin PI., Wu WF. Subunit oligomerization and substrate recognition of the Escherichia coli ClpYQ (HslUV) protease implicated by in vivo protein-protein interactions in the yeast two-hybrid system. J Bacteriol. 185(8):2393-401 (2003). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.