Transcription Factor
Accessions: | T14882 (AthalianaCistrome v4_May2016), Q9SNE1 (JASPAR 2024) |
Names: | AT3G50260, CEJ1, T14882;, ERF11_ARATH |
Organisms: | Arabidopsis thaliana |
Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP |
Length: | 153 |
Pfam Domains: | 21-69 AP2 domain |
Sequence: (in bold interface residues) | 1 MDAGVAVKADVAVKMKRERPFKGIRMRKWGKWVAEIREPNKRSRLWLGSYSTPEAAARAY 60 61 DTAVFYLRGPTATLNFPELLPCTSAEDMSAATIRKKATEVGAQVDAIGATVVQNNKRRRV 120 121 FSQKRDFGGGLLELVDLNKLPDPENLDDDLVGK |
Interface Residues: | 25, 27, 28, 29, 33, 35, 37, 42, 44, 46 |
3D-footprint Homologues: | 5wx9_A, 7wq5_A, 1gcc_A, 7et4_D |
Binding Motifs: | M0012 ccaycdcCACCGmCa M0026 wwyCACCGACMww MA1219.2 / UN0364.1 mwyCACCGACmahw MA1219.3 CACCGAC |
Binding Sites: | MA1219.2.1 / UN0364.1.1 UN0364.1.10 UN0364.1.11 MA1219.2.8 / UN0364.1.12 UN0364.1.13 UN0364.1.14 UN0364.1.15 MA1219.2.9 / UN0364.1.16 MA1219.2.10 / UN0364.1.17 MA1219.2.11 / UN0364.1.18 MA1219.2.13 / UN0364.1.19 UN0364.1.2 MA1219.2.14 / UN0364.1.20 MA1219.2.2 / UN0364.1.3 MA1219.2.3 / UN0364.1.4 MA1219.2.4 / UN0364.1.5 UN0364.1.6 MA1219.2.5 / UN0364.1.7 MA1219.2.6 / UN0364.1.8 MA1219.2.7 / UN0364.1.9 MA1219.2.12 MA1219.2.15 MA1219.2.16 MA1219.2.17 MA1219.2.18 MA1219.2.19 MA1219.2.20 MA1219.3.1 / MA1219.3.5 MA1219.3.10 / MA1219.3.14 / MA1219.3.15 / MA1219.3.16 / MA1219.3.18 / MA1219.3.19 / MA1219.3.2 / MA1219.3.3 / MA1219.3.4 / MA1219.3.6 / MA1219.3.7 MA1219.3.11 / MA1219.3.17 / MA1219.3.8 MA1219.3.12 MA1219.3.13 / MA1219.3.9 MA1219.3.20 |
Publications: | Medina J, Bargues M, Terol J, Pérez-Alonso M, Salinas J. The Arabidopsis CBF gene family is composed of three genes encoding AP2 domain-containing proteins whose expression Is regulated by low temperature but not by abscisic acid or dehydration. Plant Physiol 119:463-70 (1999). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.