Transcription Factor
Accessions: | HEN1_HUMAN (HOCOMOCO 10), Q02575 (JASPAR 2024) |
Names: | bHLHa35, Class A basic helix-loop-helix protein 35, Helix-loop-helix protein 1, HEN-1, HEN1_HUMAN, Nescient helix loop helix 1, NSCL-1 |
Organisms: | Homo sapiens |
Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Length: | 133 |
Pfam Domains: | 77-127 Helix-loop-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH 60 61 LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA 120 121 ICYISYLNHVLDV |
Interface Residues: | 77, 81, 83, 84, 87 |
3D-footprint Homologues: | 7z5k_B, 8osb_B, 8osl_P |
Binding Motifs: | MA0048.2 cGCAGCTGCk MA1938.1 aGCAGCTGCCGGAWrym HEN1_HUMAN.H10MO.C|M01202 kgGGkmkCAGCTGCGkCCyy MA0048.1 gCGCAGCTGCKy MA0048.3 cGCAGCTGC MA1938.2 aGCAGCTGCCGGAWry |
Binding Sites: | MA0048.1.1 MA0048.1.10 MA0048.1.11 MA0048.1.12 MA0048.1.13 MA0048.1.14 MA0048.1.15 MA0048.1.16 MA0048.1.17 MA0048.1.18 MA0048.1.19 MA0048.1.2 MA0048.1.20 MA0048.1.3 MA0048.1.4 MA0048.1.5 MA0048.1.6 MA0048.1.7 MA0048.1.8 MA0048.1.9 |
Publications: | Brown L., Baer R. HEN1 encodes a 20-kilodalton phosphoprotein that binds an extended E-box motif as a homodimer. Mol. Cell. Biol. 14:1245-1255 (1994). [Pubmed] Dang W, Sun XH, Sen R. ETS-mediated cooperation between basic helix-loop-helix motifs of the immunoglobulin mu heavy-chain gene enhancer. Mol Cell Biol 18:1477-88 (1998). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.