Transcription Factor

Accessions: TFEC (HT-SELEX2 May2017)
Names: ENSG00000105967, TFEC
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 104
Pfam Domains: 25-78 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 CPSSLPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMR 60
61 WNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLR
Interface Residues: 26, 29, 30, 32, 33, 34, 36, 37, 61, 63
3D-footprint Homologues: 1a0a_B, 7d8t_A, 8hov_A, 5eyo_A, 1am9_A, 7f2f_B, 5nj8_D, 4h10_A, 8ia3_B, 6g1l_A, 5gnj_I, 7ssa_L, 4h10_B, 8osl_O, 5i50_B, 7xi3_A, 5v0l_A, 4zpk_A, 8osl_P, 2ypa_B, 1an4_A, 5nj8_C, 6od3_F, 2ypa_A, 5sy7_B, 5v0l_B
Binding Motifs: TFEC_2 msCACGTGACc
TFEC_methyl_1 ryCATGTGAcc
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.