Transcription Factor

Accessions: 3rkq_A (3D-footprint 20250804)
Names: Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E, Homeobox protein Nkx-2.5, NKX25_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P52952
Length: 58
Pfam Domains: 3-58 Homeobox domain
Sequence:
(in bold interface residues)
1 GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK
Interface Residues: 2, 3, 4, 5, 6, 44, 45, 47, 48, 51, 52, 54, 55, 56
3D-footprint Homologues: 5zfz_A, 4j19_B, 3a01_E, 3d1n_M, 8pmf_A, 1fjl_B, 5zjt_E, 1puf_A, 8ejp_B, 1ig7_A, 6a8r_A, 3cmy_A, 1nk2_P, 1zq3_P, 6m3d_C, 2lkx_A, 7q3o_C, 6es3_K, 2ld5_A, 5jlw_D, 2r5y_A, 8eml_B, 1jgg_B, 4xrs_G, 2hos_A, 1au7_A, 5flv_I, 3lnq_A, 9b8u_A, 8ik5_C, 7psx_B, 1b72_A, 5hod_A, 3rkq_B, 2hdd_A, 8osb_E, 7xrc_C, 1e3o_C, 2xsd_C, 2h8r_B, 1le8_A, 1mnm_C, 1du0_A, 4cyc_A, 1puf_B, 8g87_X, 1k61_B, 1o4x_A, 8bx1_A, 4qtr_D, 4xrm_B
Binding Motifs: 3rkq_AB TCAAGAGnnnnnCACTTCA
Publications: Pradhan L, Genis C, Scone P, Weinberg E.O, Kasahara H, Nam H.J. Crystal structure of the human NKX2.5 homeodomain in complex with DNA target. Biochemistry 51:6312-9 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.